SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_3236 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_3236
Domain Number 1 Region: 425-515
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000135
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_3236
Sequence length 562
Comment (Anaeromyxobacter Fw109-5)
Sequence
MRTTTLPRDTLAGLLNAVVSVPDGLASAALAGVNPVYGLYTSIAAPLGGSPIVSAQLMQI
ATTSAAALVAGQAVAAQPAERRAEAIFLLAIVAGLFLAVFGLLRLGRLARFVSHAVMTGF
LAGVAVVLILDQLAPLVGFAARGRNPVGELANLVANVDRFDLRTVVVGVLALALASGLGR
TRLATWSSLVALLVPTILVLVAGWESVRQVEDVSPIPRGLPLPALPRLDLVSAELIASAF
ALAVVIAVQGVGVSQTVENPDGRPVDASRDLLAQGAANVASGLLSGIPAGGSVGQTALNV
AVGARSRWAGILSGVWMLVIVLLVPGLVGLVPMAALAALMIVAGLGALDLREARSIWATS
RAARWAITVTFAATLVLSVPAAVGVGVLLSIILHLASESDVTVRALVRLPDGRFAEEQPP
PRLPSEEVTVVHVQGSLFFAGARRLEEALPSPAGAVRPVVVLRLRGRTRIGATLIEVLDS
YADELEAVGGRLYLSGVEGAVRDQLRRTGKLDLERVVRVVPATTILGESTAQALASASAW
LGRSRARRPRAGRAASSPPGRR
Download sequence
Identical sequences A7HFD4
WP_012098048.1.20576 404589.Anae109_3236 gi|153006089|ref|YP_001380414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]