SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_4282 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  404589.Anae109_4282
Domain Number - Region: 121-156
Classification Level Classification E-value
Superfamily Hypothetical protein TM0875 0.0196
Family Hypothetical protein TM0875 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_4282
Sequence length 270
Comment (Anaeromyxobacter Fw109-5)
Sequence
MTTWLDREGAPFAQEVWDRIDAVARSAADEVRAGRRLLEVVGPLGFGARAGVAEDLPLGE
EPEGAHVHVPRVRPLPVIHRTFALGARALEADAACGEPLVLSEASEAARQIARAEDRIVF
EGLPRAGVSGLLGHEGAVELPAGDWSDPARVADDLLGALAKLDEAGRHGPYALAVSPGRF
YQLLRPYPGTALTPHQQLQPAFAGGIVKAPAIQDGAVIVMRTPSGPRILVGQELAAAYDG
REGIFHQISLVESVTLMPGVPGSVAVLRGR
Download sequence
Identical sequences A7HIB4
WP_012099104.1.20576 gi|153007119|ref|YP_001381444.1| 404589.Anae109_4282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]