SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405416.ACICU_01405 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405416.ACICU_01405
Domain Number 1 Region: 740-980
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.41e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 
Domain Number 2 Region: 29-206
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.77e-16
Family Pyruvate oxidase and decarboxylase Pyr module 0.066
Further Details:      
 
Domain Number 3 Region: 455-633
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000043
Family Pyruvate oxidase and decarboxylase PP module 0.051
Further Details:      
 
Domain Number 4 Region: 277-355
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000523
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.07
Further Details:      
 
Weak hits

Sequence:  405416.ACICU_01405
Domain Number - Region: 648-703
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0329
Family Short-chain ferredoxins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405416.ACICU_01405
Sequence length 1160
Comment (Acinetobacter baumannii ACICU)
Sequence
MNIATKVTPNIIATKDVSLEDKYVSDNGTAFMTGIQALVRLPLAQTRRDAINGYHTAGFI
SGYRGSPIGNYDNFLWQVEGLLKSHNVVFQPGVNEDLAATAIWGTQQANLSGQGKYDGVS
SWWYGKGPGVDRSGDVLRHANLAGTSERGGVVALFGDDHSCKSSTVPHQSEHVMIGCGIP
IFYPTSVQQILDFGVHAIAVSRFSGLWTSMKLVSEIVETSASVHVDLDRVTPVIPEDVNF
PEGGVNIRWPDHGIQQEERLYKYRLPAVLAYARANKINTVTWPCENARIGIAASGKGYLD
TIEALRILGIEDETAQQLGLRVYQVGLIWPLEPQGIREFAKGLEELIVIEEKRPILETQI
KDELYSLPDDQRPRVIGKATDGKGEWSTSIEEAPLIGHYEYQPEPIAKMLAARFLKLDIP
ESLKLQIQGRIDLLLKAEQESKRVIDLAERKPYFCSGCPHNSSTVVPEGSRALGGIGCHY
IAVSLDRGTETFSQMGGEGVSWVGASPFTNEKHIFANLGDGTYFHSGYLAIRQSIAAKTN
ITYKILYNDAVAMTGGQHVDGHLSVAQLTRQLDAEGIKKQVIVTDEIKLLNEEDGIAPGV
EIRHRNELDAVQRELREISGVTALIYVQTCASEKRRRRKRDAYPDPAERLFINTDICEGC
GDCSKKSNCLSIEPVETALGTKRQINQSSCNKDFTCAEGFCPSFVTVHTRDMKRPAKFEG
ISAGWPTSPIIPQLYDVPSRIMVGGIGGTGVVTIGALLGMAAHLEGKATRVMDMAGLAQK
GGTVYSYVQLAASDEQISSTKIPAGQCELLIGADAVVAGSGAALSRLKEDALVIVNEDST
PTSEFIKSRDWYAPITDLIDRLRGRVRQGQLVSLPAARIATLLLGDSIYTNQLLLGMAWQ
SGRIPLLRESIEKAIRLNGTAVEKNIEAFRVGCHLASDPTLAARLLAAMPKTKTPQTLAE
LVEDRSARLTDYWNEAYAAKYRTLVELAAKKLPEELTGTIATQLYRVMAYKDEYEVARLL
TGKSFKESIETQFGKGLRLTYHLAPPALLGGLKNVRKRAFGYWMRFPMMMLARLQWLRET
FLDPFARQEERQHEQAWRDRYIAFVEALVEAPDNHNLAVAEQIAKLPAEVRGYGHIKMKA
MDAAKQRWDELTPTLLKVRN
Download sequence
Identical sequences A0A0E1PS66 A0A0R1BU64 A0A231U3P0 G2JIV9
gi|387124318|ref|YP_006290200.1| gi|523526810|ref|YP_008212841.1| gi|523523740|ref|YP_008209819.1| gi|385237121|ref|YP_005798460.1| WP_001017546.1.100119 WP_001017546.1.100136 WP_001017546.1.100157 WP_001017546.1.100211 WP_001017546.1.100222 WP_001017546.1.100238 WP_001017546.1.100290 WP_001017546.1.1003 WP_001017546.1.100380 WP_001017546.1.100406 WP_001017546.1.100568 WP_001017546.1.10058 WP_001017546.1.100616 WP_001017546.1.100656 WP_001017546.1.100957 WP_001017546.1.100971 WP_001017546.1.101005 WP_001017546.1.101012 WP_001017546.1.101037 WP_001017546.1.101243 WP_001017546.1.101254 WP_001017546.1.101258 WP_001017546.1.101276 WP_001017546.1.10136 WP_001017546.1.1014 WP_001017546.1.101413 WP_001017546.1.10147 WP_001017546.1.101515 WP_001017546.1.101574 WP_001017546.1.101742 WP_001017546.1.101810 WP_001017546.1.101850 WP_001017546.1.101885 WP_001017546.1.101910 WP_001017546.1.101976 WP_001017546.1.101995 WP_001017546.1.102023 WP_001017546.1.102110 WP_001017546.1.10328 WP_001017546.1.10375 WP_001017546.1.10466 WP_001017546.1.10512 WP_001017546.1.10649 WP_001017546.1.10725 WP_001017546.1.10768 WP_001017546.1.10777 WP_001017546.1.1080 WP_001017546.1.10838 WP_001017546.1.10852 WP_001017546.1.10909 WP_001017546.1.11003 WP_001017546.1.1101 WP_001017546.1.11016 WP_001017546.1.11090 WP_001017546.1.11203 WP_001017546.1.11307 WP_001017546.1.11308 WP_001017546.1.11374 WP_001017546.1.1138 WP_001017546.1.1155 WP_001017546.1.11698 WP_001017546.1.11910 WP_001017546.1.11923 WP_001017546.1.11925 WP_001017546.1.1216 WP_001017546.1.12414 WP_001017546.1.12529 WP_001017546.1.12617 WP_001017546.1.12638 WP_001017546.1.1270 WP_001017546.1.12702 WP_001017546.1.12796 WP_001017546.1.12818 WP_001017546.1.1283 WP_001017546.1.12974 WP_001017546.1.13047 WP_001017546.1.13078 WP_001017546.1.13137 WP_001017546.1.1317 WP_001017546.1.13195 WP_001017546.1.13220 WP_001017546.1.13236 WP_001017546.1.13485 WP_001017546.1.13516 WP_001017546.1.13521 WP_001017546.1.13651 WP_001017546.1.13699 WP_001017546.1.13821 WP_001017546.1.13871 WP_001017546.1.13894 WP_001017546.1.1390 WP_001017546.1.13916 WP_001017546.1.1396 WP_001017546.1.14020 WP_001017546.1.1411 WP_001017546.1.14187 WP_001017546.1.14271 WP_001017546.1.14354 WP_001017546.1.14357 WP_001017546.1.14385 WP_001017546.1.14392 WP_001017546.1.14515 WP_001017546.1.14650 WP_001017546.1.14700 WP_001017546.1.14801 WP_001017546.1.14829 WP_001017546.1.14853 WP_001017546.1.14909 WP_001017546.1.14939 WP_001017546.1.15152 WP_001017546.1.15166 WP_001017546.1.15289 WP_001017546.1.15383 WP_001017546.1.15462 WP_001017546.1.15465 WP_001017546.1.15497 WP_001017546.1.15653 WP_001017546.1.15656 WP_001017546.1.15695 WP_001017546.1.15778 WP_001017546.1.15793 WP_001017546.1.15821 WP_001017546.1.15947 WP_001017546.1.16011 WP_001017546.1.16178 WP_001017546.1.16325 WP_001017546.1.16371 WP_001017546.1.1639 WP_001017546.1.16411 WP_001017546.1.16434 WP_001017546.1.16510 WP_001017546.1.1656 WP_001017546.1.16576 WP_001017546.1.16579 WP_001017546.1.16607 WP_001017546.1.16610 WP_001017546.1.16699 WP_001017546.1.16717 WP_001017546.1.16864 WP_001017546.1.16993 WP_001017546.1.17021 WP_001017546.1.17433 WP_001017546.1.17468 WP_001017546.1.17492 WP_001017546.1.17632 WP_001017546.1.17646 WP_001017546.1.17664 WP_001017546.1.17752 WP_001017546.1.17781 WP_001017546.1.17999 WP_001017546.1.18082 WP_001017546.1.18091 WP_001017546.1.18238 WP_001017546.1.18302 WP_001017546.1.18325 WP_001017546.1.18385 WP_001017546.1.18546 WP_001017546.1.18755 WP_001017546.1.1910 WP_001017546.1.19120 WP_001017546.1.19131 WP_001017546.1.1916 WP_001017546.1.19292 WP_001017546.1.19339 WP_001017546.1.19396 WP_001017546.1.19475 WP_001017546.1.19531 WP_001017546.1.19670 WP_001017546.1.19877 WP_001017546.1.1995 WP_001017546.1.20044 WP_001017546.1.20120 WP_001017546.1.20176 WP_001017546.1.20194 WP_001017546.1.20306 WP_001017546.1.2033 WP_001017546.1.20359 WP_001017546.1.2039 WP_001017546.1.20534 WP_001017546.1.20541 WP_001017546.1.20571 WP_001017546.1.20656 WP_001017546.1.20748 WP_001017546.1.20807 WP_001017546.1.20816 WP_001017546.1.20817 WP_001017546.1.20830 WP_001017546.1.20889 WP_001017546.1.20998 WP_001017546.1.21032 WP_001017546.1.21112 WP_001017546.1.21117 WP_001017546.1.21264 WP_001017546.1.21337 WP_001017546.1.21484 WP_001017546.1.21546 WP_001017546.1.21689 WP_001017546.1.21738 WP_001017546.1.21747 WP_001017546.1.21939 WP_001017546.1.22047 WP_001017546.1.22053 WP_001017546.1.22108 WP_001017546.1.22209 WP_001017546.1.22286 WP_001017546.1.22301 WP_001017546.1.22349 WP_001017546.1.22452 WP_001017546.1.22469 WP_001017546.1.22515 WP_001017546.1.22586 WP_001017546.1.22687 WP_001017546.1.23141 WP_001017546.1.23173 WP_001017546.1.23188 WP_001017546.1.23243 WP_001017546.1.23328 WP_001017546.1.23401 WP_001017546.1.23636 WP_001017546.1.23651 WP_001017546.1.23669 WP_001017546.1.2386 WP_001017546.1.23975 WP_001017546.1.23997 WP_001017546.1.24015 WP_001017546.1.24041 WP_001017546.1.24097 WP_001017546.1.24152 WP_001017546.1.24178 WP_001017546.1.24260 WP_001017546.1.24358 WP_001017546.1.24373 WP_001017546.1.24449 WP_001017546.1.2445 WP_001017546.1.24545 WP_001017546.1.24621 WP_001017546.1.24706 WP_001017546.1.24744 WP_001017546.1.24927 WP_001017546.1.25091 WP_001017546.1.25143 WP_001017546.1.25263 WP_001017546.1.25292 WP_001017546.1.25478 WP_001017546.1.25519 WP_001017546.1.25524 WP_001017546.1.25560 WP_001017546.1.2559 WP_001017546.1.2561 WP_001017546.1.25689 WP_001017546.1.25723 WP_001017546.1.2585 WP_001017546.1.25850 WP_001017546.1.25971 WP_001017546.1.26204 WP_001017546.1.2626 WP_001017546.1.26352 WP_001017546.1.26425 WP_001017546.1.26436 WP_001017546.1.26472 WP_001017546.1.26504 WP_001017546.1.26528 WP_001017546.1.26647 WP_001017546.1.26649 WP_001017546.1.26669 WP_001017546.1.26678 WP_001017546.1.26744 WP_001017546.1.26946 WP_001017546.1.27059 WP_001017546.1.27109 WP_001017546.1.27176 WP_001017546.1.27270 WP_001017546.1.273 WP_001017546.1.2730 WP_001017546.1.27346 WP_001017546.1.2736 WP_001017546.1.2738 WP_001017546.1.27509 WP_001017546.1.2762 WP_001017546.1.2769 WP_001017546.1.27704 WP_001017546.1.27801 WP_001017546.1.27845 WP_001017546.1.27852 WP_001017546.1.27934 WP_001017546.1.27983 WP_001017546.1.28048 WP_001017546.1.28101 WP_001017546.1.28141 WP_001017546.1.28204 WP_001017546.1.28320 WP_001017546.1.28385 WP_001017546.1.28405 WP_001017546.1.28411 WP_001017546.1.28507 WP_001017546.1.28513 WP_001017546.1.28601 WP_001017546.1.28677 WP_001017546.1.28774 WP_001017546.1.28883 WP_001017546.1.28898 WP_001017546.1.28929 WP_001017546.1.28937 WP_001017546.1.29074 WP_001017546.1.29117 WP_001017546.1.29123 WP_001017546.1.29216 WP_001017546.1.29229 WP_001017546.1.29347 WP_001017546.1.29362 WP_001017546.1.29434 WP_001017546.1.29455 WP_001017546.1.29552 WP_001017546.1.2979 WP_001017546.1.29817 WP_001017546.1.29824 WP_001017546.1.29897 WP_001017546.1.30026 WP_001017546.1.30083 WP_001017546.1.30161 WP_001017546.1.30309 WP_001017546.1.30407 WP_001017546.1.30490 WP_001017546.1.30611 WP_001017546.1.30667 WP_001017546.1.30673 WP_001017546.1.3075 WP_001017546.1.30776 WP_001017546.1.30856 WP_001017546.1.30932 WP_001017546.1.30969 WP_001017546.1.30978 WP_001017546.1.30996 WP_001017546.1.31141 WP_001017546.1.3116 WP_001017546.1.31328 WP_001017546.1.31430 WP_001017546.1.3144 WP_001017546.1.3162 WP_001017546.1.3163 WP_001017546.1.31729 WP_001017546.1.31810 WP_001017546.1.31834 WP_001017546.1.3198 WP_001017546.1.31980 WP_001017546.1.32028 WP_001017546.1.32065 WP_001017546.1.32129 WP_001017546.1.32257 WP_001017546.1.32272 WP_001017546.1.32304 WP_001017546.1.32386 WP_001017546.1.32487 WP_001017546.1.32579 WP_001017546.1.32682 WP_001017546.1.32773 WP_001017546.1.3280 WP_001017546.1.32830 WP_001017546.1.32845 WP_001017546.1.32956 WP_001017546.1.3303 WP_001017546.1.33154 WP_001017546.1.33262 WP_001017546.1.33370 WP_001017546.1.33386 WP_001017546.1.33447 WP_001017546.1.3346 WP_001017546.1.33495 WP_001017546.1.33541 WP_001017546.1.33558 WP_001017546.1.33706 WP_001017546.1.33714 WP_001017546.1.33777 WP_001017546.1.33805 WP_001017546.1.33869 WP_001017546.1.33902 WP_001017546.1.33929 WP_001017546.1.33978 WP_001017546.1.33999 WP_001017546.1.34027 WP_001017546.1.34045 WP_001017546.1.34049 WP_001017546.1.34207 WP_001017546.1.34394 WP_001017546.1.34618 WP_001017546.1.34642 WP_001017546.1.34859 WP_001017546.1.35000 WP_001017546.1.35018 WP_001017546.1.35046 WP_001017546.1.35250 WP_001017546.1.35327 WP_001017546.1.3535 WP_001017546.1.35461 WP_001017546.1.35558 WP_001017546.1.35588 WP_001017546.1.35601 WP_001017546.1.35715 WP_001017546.1.35717 WP_001017546.1.35728 WP_001017546.1.35758 WP_001017546.1.35761 WP_001017546.1.35828 WP_001017546.1.35883 WP_001017546.1.35912 WP_001017546.1.36327 WP_001017546.1.36355 WP_001017546.1.36358 WP_001017546.1.36359 WP_001017546.1.36418 WP_001017546.1.36517 WP_001017546.1.36549 WP_001017546.1.36569 WP_001017546.1.36694 WP_001017546.1.36714 WP_001017546.1.36735 WP_001017546.1.36866 WP_001017546.1.36882 WP_001017546.1.36909 WP_001017546.1.36938 WP_001017546.1.3712 WP_001017546.1.37215 WP_001017546.1.37437 WP_001017546.1.3758 WP_001017546.1.37603 WP_001017546.1.37607 WP_001017546.1.37680 WP_001017546.1.37729 WP_001017546.1.37893 WP_001017546.1.37963 WP_001017546.1.37982 WP_001017546.1.38009 WP_001017546.1.38122 WP_001017546.1.38249 WP_001017546.1.38320 WP_001017546.1.3837 WP_001017546.1.3843 WP_001017546.1.3861 WP_001017546.1.38628 WP_001017546.1.38732 WP_001017546.1.38748 WP_001017546.1.38779 WP_001017546.1.38901 WP_001017546.1.38964 WP_001017546.1.39019 WP_001017546.1.39353 WP_001017546.1.39399 WP_001017546.1.39680 WP_001017546.1.39688 WP_001017546.1.397 WP_001017546.1.3974 WP_001017546.1.39911 WP_001017546.1.39928 WP_001017546.1.40200 WP_001017546.1.40225 WP_001017546.1.40233 WP_001017546.1.40297 WP_001017546.1.40332 WP_001017546.1.4047 WP_001017546.1.40490 WP_001017546.1.40547 WP_001017546.1.40832 WP_001017546.1.40836 WP_001017546.1.4086 WP_001017546.1.40864 WP_001017546.1.40947 WP_001017546.1.41029 WP_001017546.1.41059 WP_001017546.1.4110 WP_001017546.1.41201 WP_001017546.1.41266 WP_001017546.1.41425 WP_001017546.1.41507 WP_001017546.1.41546 WP_001017546.1.4164 WP_001017546.1.41707 WP_001017546.1.41720 WP_001017546.1.41738 WP_001017546.1.41777 WP_001017546.1.41838 WP_001017546.1.41922 WP_001017546.1.41936 WP_001017546.1.42080 WP_001017546.1.42172 WP_001017546.1.42253 WP_001017546.1.42289 WP_001017546.1.42351 WP_001017546.1.42401 WP_001017546.1.42484 WP_001017546.1.42531 WP_001017546.1.42561 WP_001017546.1.42765 WP_001017546.1.4277 WP_001017546.1.42773 WP_001017546.1.4281 WP_001017546.1.42824 WP_001017546.1.42888 WP_001017546.1.42928 WP_001017546.1.43011 WP_001017546.1.43028 WP_001017546.1.43094 WP_001017546.1.431 WP_001017546.1.4311 WP_001017546.1.43175 WP_001017546.1.43194 WP_001017546.1.43203 WP_001017546.1.43227 WP_001017546.1.43340 WP_001017546.1.43439 WP_001017546.1.43641 WP_001017546.1.43645 WP_001017546.1.43751 WP_001017546.1.43755 WP_001017546.1.43759 WP_001017546.1.4396 WP_001017546.1.43978 WP_001017546.1.44009 WP_001017546.1.44342 WP_001017546.1.44370 WP_001017546.1.44372 WP_001017546.1.44407 WP_001017546.1.44613 WP_001017546.1.44664 WP_001017546.1.44684 WP_001017546.1.44770 WP_001017546.1.44809 WP_001017546.1.44886 WP_001017546.1.44926 WP_001017546.1.44929 WP_001017546.1.44944 WP_001017546.1.44991 WP_001017546.1.45233 WP_001017546.1.45291 WP_001017546.1.45350 WP_001017546.1.4537 WP_001017546.1.45399 WP_001017546.1.45457 WP_001017546.1.45587 WP_001017546.1.45637 WP_001017546.1.45647 WP_001017546.1.45675 WP_001017546.1.45761 WP_001017546.1.45839 WP_001017546.1.45916 WP_001017546.1.46108 WP_001017546.1.46138 WP_001017546.1.46246 WP_001017546.1.46255 WP_001017546.1.46258 WP_001017546.1.46338 WP_001017546.1.46385 WP_001017546.1.46392 WP_001017546.1.46413 WP_001017546.1.46474 WP_001017546.1.4648 WP_001017546.1.46493 WP_001017546.1.46518 WP_001017546.1.46577 WP_001017546.1.46739 WP_001017546.1.46762 WP_001017546.1.46774 WP_001017546.1.46827 WP_001017546.1.4683 WP_001017546.1.46850 WP_001017546.1.46918 WP_001017546.1.46950 WP_001017546.1.46959 WP_001017546.1.47241 WP_001017546.1.47298 WP_001017546.1.47388 WP_001017546.1.47515 WP_001017546.1.47543 WP_001017546.1.47552 WP_001017546.1.47715 WP_001017546.1.47816 WP_001017546.1.47828 WP_001017546.1.47863 WP_001017546.1.47903 WP_001017546.1.48042 WP_001017546.1.48115 WP_001017546.1.4819 WP_001017546.1.4824 WP_001017546.1.48280 WP_001017546.1.48380 WP_001017546.1.48415 WP_001017546.1.48457 WP_001017546.1.48509 WP_001017546.1.48642 WP_001017546.1.48692 WP_001017546.1.48700 WP_001017546.1.48785 WP_001017546.1.48824 WP_001017546.1.4887 WP_001017546.1.489 WP_001017546.1.48988 WP_001017546.1.49083 WP_001017546.1.4911 WP_001017546.1.49261 WP_001017546.1.49318 WP_001017546.1.4935 WP_001017546.1.49380 WP_001017546.1.49405 WP_001017546.1.4941 WP_001017546.1.49564 WP_001017546.1.49639 WP_001017546.1.4967 WP_001017546.1.49705 WP_001017546.1.49789 WP_001017546.1.49866 WP_001017546.1.49896 WP_001017546.1.49928 WP_001017546.1.49960 WP_001017546.1.49992 WP_001017546.1.50011 WP_001017546.1.50208 WP_001017546.1.50223 WP_001017546.1.50267 WP_001017546.1.50298 WP_001017546.1.503 WP_001017546.1.50617 WP_001017546.1.50641 WP_001017546.1.50705 WP_001017546.1.50789 WP_001017546.1.50815 WP_001017546.1.50851 WP_001017546.1.50859 WP_001017546.1.50867 WP_001017546.1.50872 WP_001017546.1.51063 WP_001017546.1.51303 WP_001017546.1.51328 WP_001017546.1.51369 WP_001017546.1.51437 WP_001017546.1.51569 WP_001017546.1.51578 WP_001017546.1.51597 WP_001017546.1.51663 WP_001017546.1.5171 WP_001017546.1.51856 WP_001017546.1.51861 WP_001017546.1.5193 WP_001017546.1.51966 WP_001017546.1.52032 WP_001017546.1.5206 WP_001017546.1.52103 WP_001017546.1.52138 WP_001017546.1.52189 WP_001017546.1.5220 WP_001017546.1.52325 WP_001017546.1.52392 WP_001017546.1.52445 WP_001017546.1.52619 WP_001017546.1.5274 WP_001017546.1.52769 WP_001017546.1.52779 WP_001017546.1.5281 WP_001017546.1.52837 WP_001017546.1.52839 WP_001017546.1.52840 WP_001017546.1.52885 WP_001017546.1.52980 WP_001017546.1.52982 WP_001017546.1.53023 WP_001017546.1.53052 WP_001017546.1.53097 WP_001017546.1.53146 WP_001017546.1.53331 WP_001017546.1.53390 WP_001017546.1.53424 WP_001017546.1.53498 WP_001017546.1.53533 WP_001017546.1.53593 WP_001017546.1.53616 WP_001017546.1.53762 WP_001017546.1.53854 WP_001017546.1.53954 WP_001017546.1.54 WP_001017546.1.54055 WP_001017546.1.54088 WP_001017546.1.5412 WP_001017546.1.54139 WP_001017546.1.54352 WP_001017546.1.54361 WP_001017546.1.54451 WP_001017546.1.54566 WP_001017546.1.54581 WP_001017546.1.54664 WP_001017546.1.54741 WP_001017546.1.54761 WP_001017546.1.5489 WP_001017546.1.54963 WP_001017546.1.54977 WP_001017546.1.55062 WP_001017546.1.55096 WP_001017546.1.55155 WP_001017546.1.55201 WP_001017546.1.55321 WP_001017546.1.55363 WP_001017546.1.55368 WP_001017546.1.55376 WP_001017546.1.55516 WP_001017546.1.55638 WP_001017546.1.55773 WP_001017546.1.55799 WP_001017546.1.55952 WP_001017546.1.55997 WP_001017546.1.56027 WP_001017546.1.56067 WP_001017546.1.56076 WP_001017546.1.56102 WP_001017546.1.56165 WP_001017546.1.56211 WP_001017546.1.56246 WP_001017546.1.56379 WP_001017546.1.56668 WP_001017546.1.56712 WP_001017546.1.56717 WP_001017546.1.56798 WP_001017546.1.56833 WP_001017546.1.56841 WP_001017546.1.5697 WP_001017546.1.57078 WP_001017546.1.57346 WP_001017546.1.57408 WP_001017546.1.57457 WP_001017546.1.57465 WP_001017546.1.57535 WP_001017546.1.57543 WP_001017546.1.57606 WP_001017546.1.57654 WP_001017546.1.5769 WP_001017546.1.5780 WP_001017546.1.57829 WP_001017546.1.57874 WP_001017546.1.58061 WP_001017546.1.58115 WP_001017546.1.5822 WP_001017546.1.58269 WP_001017546.1.58337 WP_001017546.1.58453 WP_001017546.1.58506 WP_001017546.1.58621 WP_001017546.1.58969 WP_001017546.1.590 WP_001017546.1.59078 WP_001017546.1.59107 WP_001017546.1.59325 WP_001017546.1.59416 WP_001017546.1.59476 WP_001017546.1.59488 WP_001017546.1.59522 WP_001017546.1.5961 WP_001017546.1.59649 WP_001017546.1.59754 WP_001017546.1.59765 WP_001017546.1.59897 WP_001017546.1.600 WP_001017546.1.60059 WP_001017546.1.60099 WP_001017546.1.60108 WP_001017546.1.60116 WP_001017546.1.60198 WP_001017546.1.60243 WP_001017546.1.60299 WP_001017546.1.60316 WP_001017546.1.60318 WP_001017546.1.60359 WP_001017546.1.60474 WP_001017546.1.60581 WP_001017546.1.60589 WP_001017546.1.60609 WP_001017546.1.60616 WP_001017546.1.60655 WP_001017546.1.60669 WP_001017546.1.60697 WP_001017546.1.61105 WP_001017546.1.61291 WP_001017546.1.61336 WP_001017546.1.61410 WP_001017546.1.61441 WP_001017546.1.61477 WP_001017546.1.61527 WP_001017546.1.61578 WP_001017546.1.61704 WP_001017546.1.62011 WP_001017546.1.62067 WP_001017546.1.62150 WP_001017546.1.62191 WP_001017546.1.62308 WP_001017546.1.62368 WP_001017546.1.624 WP_001017546.1.62428 WP_001017546.1.62543 WP_001017546.1.6257 WP_001017546.1.62712 WP_001017546.1.62767 WP_001017546.1.6277 WP_001017546.1.62868 WP_001017546.1.62924 WP_001017546.1.62935 WP_001017546.1.63028 WP_001017546.1.63219 WP_001017546.1.63252 WP_001017546.1.63303 WP_001017546.1.63340 WP_001017546.1.63391 WP_001017546.1.63405 WP_001017546.1.63426 WP_001017546.1.63429 WP_001017546.1.6352 WP_001017546.1.63609 WP_001017546.1.63639 WP_001017546.1.63681 WP_001017546.1.63857 WP_001017546.1.63933 WP_001017546.1.64129 WP_001017546.1.64218 WP_001017546.1.64310 WP_001017546.1.64428 WP_001017546.1.64465 WP_001017546.1.64604 WP_001017546.1.64834 WP_001017546.1.64907 WP_001017546.1.64955 WP_001017546.1.65003 WP_001017546.1.65005 WP_001017546.1.65058 WP_001017546.1.6513 WP_001017546.1.65267 WP_001017546.1.65325 WP_001017546.1.65342 WP_001017546.1.65373 WP_001017546.1.65496 WP_001017546.1.65560 WP_001017546.1.65592 WP_001017546.1.65630 WP_001017546.1.65804 WP_001017546.1.65890 WP_001017546.1.65939 WP_001017546.1.65955 WP_001017546.1.65995 WP_001017546.1.66140 WP_001017546.1.66142 WP_001017546.1.66189 WP_001017546.1.66200 WP_001017546.1.66210 WP_001017546.1.66215 WP_001017546.1.66431 WP_001017546.1.66458 WP_001017546.1.66491 WP_001017546.1.66496 WP_001017546.1.66541 WP_001017546.1.66591 WP_001017546.1.66636 WP_001017546.1.66689 WP_001017546.1.66716 WP_001017546.1.66717 WP_001017546.1.66782 WP_001017546.1.66806 WP_001017546.1.66899 WP_001017546.1.67009 WP_001017546.1.67361 WP_001017546.1.67426 WP_001017546.1.67486 WP_001017546.1.67597 WP_001017546.1.67656 WP_001017546.1.67728 WP_001017546.1.67862 WP_001017546.1.67869 WP_001017546.1.67922 WP_001017546.1.67939 WP_001017546.1.68065 WP_001017546.1.68087 WP_001017546.1.68119 WP_001017546.1.68132 WP_001017546.1.68168 WP_001017546.1.68225 WP_001017546.1.68315 WP_001017546.1.6841 WP_001017546.1.68428 WP_001017546.1.68454 WP_001017546.1.6851 WP_001017546.1.6861 WP_001017546.1.68698 WP_001017546.1.68830 WP_001017546.1.68837 WP_001017546.1.68858 WP_001017546.1.68885 WP_001017546.1.689 WP_001017546.1.68930 WP_001017546.1.69121 WP_001017546.1.69172 WP_001017546.1.69242 WP_001017546.1.69257 WP_001017546.1.69364 WP_001017546.1.69379 WP_001017546.1.69419 WP_001017546.1.69424 WP_001017546.1.69478 WP_001017546.1.6952 WP_001017546.1.69568 WP_001017546.1.69586 WP_001017546.1.69665 WP_001017546.1.69815 WP_001017546.1.69929 WP_001017546.1.69930 WP_001017546.1.70025 WP_001017546.1.70154 WP_001017546.1.70283 WP_001017546.1.70354 WP_001017546.1.70542 WP_001017546.1.70827 WP_001017546.1.70891 WP_001017546.1.71151 WP_001017546.1.71168 WP_001017546.1.71204 WP_001017546.1.71220 WP_001017546.1.71335 WP_001017546.1.71413 WP_001017546.1.71435 WP_001017546.1.71539 WP_001017546.1.71650 WP_001017546.1.71796 WP_001017546.1.71823 WP_001017546.1.71825 WP_001017546.1.71857 WP_001017546.1.71876 WP_001017546.1.71960 WP_001017546.1.71969 WP_001017546.1.71971 WP_001017546.1.72084 WP_001017546.1.7213 WP_001017546.1.72158 WP_001017546.1.72295 WP_001017546.1.72317 WP_001017546.1.72334 WP_001017546.1.7244 WP_001017546.1.72538 WP_001017546.1.72997 WP_001017546.1.73076 WP_001017546.1.73146 WP_001017546.1.73341 WP_001017546.1.73348 WP_001017546.1.73375 WP_001017546.1.73434 WP_001017546.1.73446 WP_001017546.1.73542 WP_001017546.1.73699 WP_001017546.1.73806 WP_001017546.1.73867 WP_001017546.1.73875 WP_001017546.1.73932 WP_001017546.1.74122 WP_001017546.1.74312 WP_001017546.1.74424 WP_001017546.1.74463 WP_001017546.1.7453 WP_001017546.1.74700 WP_001017546.1.74709 WP_001017546.1.74711 WP_001017546.1.74819 WP_001017546.1.74838 WP_001017546.1.74869 WP_001017546.1.74930 WP_001017546.1.75104 WP_001017546.1.75105 WP_001017546.1.75107 WP_001017546.1.75121 WP_001017546.1.75212 WP_001017546.1.75225 WP_001017546.1.75386 WP_001017546.1.75412 WP_001017546.1.75459 WP_001017546.1.75562 WP_001017546.1.75738 WP_001017546.1.75812 WP_001017546.1.75859 WP_001017546.1.75895 WP_001017546.1.75939 WP_001017546.1.76026 WP_001017546.1.7606 WP_001017546.1.76101 WP_001017546.1.76117 WP_001017546.1.76250 WP_001017546.1.76260 WP_001017546.1.76372 WP_001017546.1.76464 WP_001017546.1.76493 WP_001017546.1.76523 WP_001017546.1.76587 WP_001017546.1.7662 WP_001017546.1.76682 WP_001017546.1.76698 WP_001017546.1.76787 WP_001017546.1.76809 WP_001017546.1.76871 WP_001017546.1.76953 WP_001017546.1.76981 WP_001017546.1.77237 WP_001017546.1.77257 WP_001017546.1.77347 WP_001017546.1.77539 WP_001017546.1.7757 WP_001017546.1.77634 WP_001017546.1.77711 WP_001017546.1.77758 WP_001017546.1.77787 WP_001017546.1.77815 WP_001017546.1.77891 WP_001017546.1.77903 WP_001017546.1.7791 WP_001017546.1.77996 WP_001017546.1.78042 WP_001017546.1.7816 WP_001017546.1.78240 WP_001017546.1.7825 WP_001017546.1.78263 WP_001017546.1.78355 WP_001017546.1.78505 WP_001017546.1.7866 WP_001017546.1.78660 WP_001017546.1.78769 WP_001017546.1.78783 WP_001017546.1.78805 WP_001017546.1.78808 WP_001017546.1.79028 WP_001017546.1.79072 WP_001017546.1.79078 WP_001017546.1.79181 WP_001017546.1.79229 WP_001017546.1.79260 WP_001017546.1.79261 WP_001017546.1.79284 WP_001017546.1.793 WP_001017546.1.7938 WP_001017546.1.79405 WP_001017546.1.7949 WP_001017546.1.79567 WP_001017546.1.79701 WP_001017546.1.79720 WP_001017546.1.79728 WP_001017546.1.79736 WP_001017546.1.79774 WP_001017546.1.7978 WP_001017546.1.79889 WP_001017546.1.79909 WP_001017546.1.79938 WP_001017546.1.80092 WP_001017546.1.80121 WP_001017546.1.80125 WP_001017546.1.80143 WP_001017546.1.80162 WP_001017546.1.80195 WP_001017546.1.8021 WP_001017546.1.80665 WP_001017546.1.80730 WP_001017546.1.80887 WP_001017546.1.80897 WP_001017546.1.80987 WP_001017546.1.80997 WP_001017546.1.81002 WP_001017546.1.81068 WP_001017546.1.81161 WP_001017546.1.81240 WP_001017546.1.81253 WP_001017546.1.81319 WP_001017546.1.81345 WP_001017546.1.81412 WP_001017546.1.81441 WP_001017546.1.81466 WP_001017546.1.81700 WP_001017546.1.81704 WP_001017546.1.82039 WP_001017546.1.82040 WP_001017546.1.82082 WP_001017546.1.82090 WP_001017546.1.82110 WP_001017546.1.82203 WP_001017546.1.82235 WP_001017546.1.82286 WP_001017546.1.8230 WP_001017546.1.82366 WP_001017546.1.82453 WP_001017546.1.82504 WP_001017546.1.82538 WP_001017546.1.82561 WP_001017546.1.82786 WP_001017546.1.828 WP_001017546.1.82809 WP_001017546.1.82848 WP_001017546.1.82861 WP_001017546.1.83001 WP_001017546.1.8301 WP_001017546.1.83098 WP_001017546.1.8312 WP_001017546.1.83178 WP_001017546.1.83400 WP_001017546.1.83410 WP_001017546.1.83450 WP_001017546.1.83474 WP_001017546.1.83594 WP_001017546.1.83693 WP_001017546.1.8377 WP_001017546.1.838 WP_001017546.1.83889 WP_001017546.1.84012 WP_001017546.1.84058 WP_001017546.1.84139 WP_001017546.1.84171 WP_001017546.1.84247 WP_001017546.1.84250 WP_001017546.1.84332 WP_001017546.1.84387 WP_001017546.1.84490 WP_001017546.1.84527 WP_001017546.1.84536 WP_001017546.1.84550 WP_001017546.1.84571 WP_001017546.1.84618 WP_001017546.1.84688 WP_001017546.1.84691 WP_001017546.1.84706 WP_001017546.1.8472 WP_001017546.1.84769 WP_001017546.1.84864 WP_001017546.1.84898 WP_001017546.1.84921 WP_001017546.1.84944 WP_001017546.1.85149 WP_001017546.1.85158 WP_001017546.1.85168 WP_001017546.1.85185 WP_001017546.1.85299 WP_001017546.1.85364 WP_001017546.1.85472 WP_001017546.1.85493 WP_001017546.1.85544 WP_001017546.1.85616 WP_001017546.1.85711 WP_001017546.1.85716 WP_001017546.1.85743 WP_001017546.1.85833 WP_001017546.1.85846 WP_001017546.1.85889 WP_001017546.1.85922 WP_001017546.1.8596 WP_001017546.1.86100 WP_001017546.1.86163 WP_001017546.1.86242 WP_001017546.1.86277 WP_001017546.1.86324 WP_001017546.1.86385 WP_001017546.1.86536 WP_001017546.1.86715 WP_001017546.1.86890 WP_001017546.1.86908 WP_001017546.1.86922 WP_001017546.1.86976 WP_001017546.1.87048 WP_001017546.1.87099 WP_001017546.1.87111 WP_001017546.1.87312 WP_001017546.1.87598 WP_001017546.1.87688 WP_001017546.1.87727 WP_001017546.1.87746 WP_001017546.1.87830 WP_001017546.1.88109 WP_001017546.1.88115 WP_001017546.1.88131 WP_001017546.1.88163 WP_001017546.1.88183 WP_001017546.1.88512 WP_001017546.1.88596 WP_001017546.1.8860 WP_001017546.1.88613 WP_001017546.1.88654 WP_001017546.1.88956 WP_001017546.1.89172 WP_001017546.1.89199 WP_001017546.1.89209 WP_001017546.1.89218 WP_001017546.1.89289 WP_001017546.1.89376 WP_001017546.1.89383 WP_001017546.1.89459 WP_001017546.1.89484 WP_001017546.1.89568 WP_001017546.1.89611 WP_001017546.1.89653 WP_001017546.1.89685 WP_001017546.1.89790 WP_001017546.1.89792 WP_001017546.1.89836 WP_001017546.1.89878 WP_001017546.1.90087 WP_001017546.1.90132 WP_001017546.1.90262 WP_001017546.1.90310 WP_001017546.1.90378 WP_001017546.1.9038 WP_001017546.1.90413 WP_001017546.1.90656 WP_001017546.1.90697 WP_001017546.1.90704 WP_001017546.1.90743 WP_001017546.1.90755 WP_001017546.1.90932 WP_001017546.1.90953 WP_001017546.1.91085 WP_001017546.1.91147 WP_001017546.1.91206 WP_001017546.1.91286 WP_001017546.1.91335 WP_001017546.1.91355 WP_001017546.1.91477 WP_001017546.1.91502 WP_001017546.1.91523 WP_001017546.1.91696 WP_001017546.1.9172 WP_001017546.1.91762 WP_001017546.1.91780 WP_001017546.1.91789 WP_001017546.1.91854 WP_001017546.1.91908 WP_001017546.1.91941 WP_001017546.1.91998 WP_001017546.1.92112 WP_001017546.1.92179 WP_001017546.1.9228 WP_001017546.1.9233 WP_001017546.1.92365 WP_001017546.1.92515 WP_001017546.1.92687 WP_001017546.1.92711 WP_001017546.1.92749 WP_001017546.1.92945 WP_001017546.1.92998 WP_001017546.1.9309 WP_001017546.1.93094 WP_001017546.1.93114 WP_001017546.1.93151 WP_001017546.1.93280 WP_001017546.1.93451 WP_001017546.1.93580 WP_001017546.1.93682 WP_001017546.1.93778 WP_001017546.1.93796 WP_001017546.1.93849 WP_001017546.1.93868 WP_001017546.1.93948 WP_001017546.1.93991 WP_001017546.1.94015 WP_001017546.1.94144 WP_001017546.1.94265 WP_001017546.1.94387 WP_001017546.1.94410 WP_001017546.1.94725 WP_001017546.1.94740 WP_001017546.1.94826 WP_001017546.1.94900 WP_001017546.1.94948 WP_001017546.1.95026 WP_001017546.1.95040 WP_001017546.1.95092 WP_001017546.1.95109 WP_001017546.1.95111 WP_001017546.1.95220 WP_001017546.1.95260 WP_001017546.1.95269 WP_001017546.1.95270 WP_001017546.1.9536 WP_001017546.1.95539 WP_001017546.1.95622 WP_001017546.1.95653 WP_001017546.1.95665 WP_001017546.1.95755 WP_001017546.1.95844 WP_001017546.1.95859 WP_001017546.1.95873 WP_001017546.1.95923 WP_001017546.1.9593 WP_001017546.1.96029 WP_001017546.1.96046 WP_001017546.1.962 WP_001017546.1.96323 WP_001017546.1.9645 WP_001017546.1.96556 WP_001017546.1.96598 WP_001017546.1.96696 WP_001017546.1.96747 WP_001017546.1.96942 WP_001017546.1.96998 WP_001017546.1.97032 WP_001017546.1.9714 WP_001017546.1.97163 WP_001017546.1.9733 WP_001017546.1.97520 WP_001017546.1.97709 WP_001017546.1.97710 WP_001017546.1.97780 WP_001017546.1.97844 WP_001017546.1.97893 WP_001017546.1.97920 WP_001017546.1.9794 WP_001017546.1.98004 WP_001017546.1.98007 WP_001017546.1.98150 WP_001017546.1.98224 WP_001017546.1.98272 WP_001017546.1.9832 WP_001017546.1.98354 WP_001017546.1.98434 WP_001017546.1.98523 WP_001017546.1.98561 WP_001017546.1.98691 WP_001017546.1.98692 WP_001017546.1.987 WP_001017546.1.98806 WP_001017546.1.98835 WP_001017546.1.98919 WP_001017546.1.98950 WP_001017546.1.98965 WP_001017546.1.98968 WP_001017546.1.98986 WP_001017546.1.98998 WP_001017546.1.99049 WP_001017546.1.99077 WP_001017546.1.99120 WP_001017546.1.99162 WP_001017546.1.99188 WP_001017546.1.99206 WP_001017546.1.99250 WP_001017546.1.99391 WP_001017546.1.99420 WP_001017546.1.99449 WP_001017546.1.99464 WP_001017546.1.9952 WP_001017546.1.99555 WP_001017546.1.99653 WP_001017546.1.99775 WP_001017546.1.99825 WP_001017546.1.99833 WP_001017546.1.99868 WP_001017546.1.99964 WP_001017546.1.9997 gi|384142811|ref|YP_005525521.1| gi|407932441|ref|YP_006848084.1| 405416.ACICU_01405 gi|184157725|ref|YP_001846064.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]