SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405440.Xfasm12_0156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  405440.Xfasm12_0156
Domain Number - Region: 96-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.011
Family NfeD domain-like 0.0084
Further Details:      
 
Domain Number - Region: 16-68
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0785
Family ABC transporter transmembrane region 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405440.Xfasm12_0156
Sequence length 138
Comment (Xylella fastidiosa M12)
Sequence
MGWAAAALLLLAAETLIPGAFMLWMGIAAAAMFVGVLLLPDTSLLLQMFAFVVLSFVSIY
LYRTWFRSVDHDSDHPLLNRRADQLVGRIIILDHAIVDGNARIKIDDTFWDITGPDLPIG
TQIRIVALDGATLKVHPT
Download sequence
Identical sequences Q3RFE4
405440.Xfasm12_0156 gi|170729390|ref|YP_001774823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]