SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405440.Xfasm12_0628 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  405440.Xfasm12_0628
Domain Number - Region: 17-95
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00122
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405440.Xfasm12_0628
Sequence length 372
Comment (Xylella fastidiosa M12)
Sequence
MPKKTVTAPHIEQDAQDRGQIHLSGSWVLANVLTASELLQSYSNSIQHINARNIDQLDSA
GALQLLRFATRTGLKNEAIEFREEHRPLISTIEILDDEHPKPERDYGFLAALERLGIAVV
KTRRNIIDVCSFLGENLVKIAQLAREPRRFRITSTVHHMEQVGLDAVPLVVVLSYLVGAV
IAFLGSTILRNFGAEIFVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEI
DAIQTLGLDPIDLLVIPRLIALLVMLPLLTFIAMIAGLAGGITVGAFDLGIPPQMYLSRM
HETMQFRHFIIGMSKAPLFALIIGLIGCLEGLKVTGTAQSVGKHTTSSVVQTISLVIIID
ALAALWFMRMGW
Download sequence
Identical sequences A0A0Q2WUP7 Q3RGW1
gi|170729829|ref|YP_001775262.1| WP_004083972.1.28558 WP_004083972.1.34418 WP_004083972.1.34606 WP_004083972.1.35854 WP_004083972.1.45638 WP_004083972.1.46267 WP_004083972.1.63667 WP_004083972.1.67057 WP_004083972.1.86577 WP_004083972.1.93345 405440.Xfasm12_0628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]