SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405440.Xfasm12_1192 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405440.Xfasm12_1192
Domain Number 1 Region: 88-283
Classification Level Classification E-value
Superfamily Formyltransferase 4.58e-60
Family Formyltransferase 0.00019
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily ACT-like 4.16e-18
Family SP0238-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 405440.Xfasm12_1192
Sequence length 283
Comment (Xylella fastidiosa M12)
Sequence
MRHDYILTLSCPDCTGLVYRISGELFRAGCNILDAQQFVDKESHQFFLRVHFDLADSSSL
AELQNQINILAKAYAMQWQLHDARRRSRLLVMVSKQGHCLNDLLFRIHSRQLQAKIVTVV
SNHNEFAPLTASYGVPFQHLPVNGENRTEQEARILQIVEREQIDLVILARYMQILSPALC
EALLGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTHDLDEGPIIEQDVARVD
HSMTAHDLVRIGSDIESLVLARAVSRHIEHRILLNGHRTVVFR
Download sequence
Identical sequences A0A1R2D6Q0 Q3RFS9
gi|170730340|ref|YP_001775773.1| 405440.Xfasm12_1192 WP_004084866.1.34606 WP_004084866.1.35854 WP_004084866.1.45638 WP_004084866.1.530 WP_004084866.1.63667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]