SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405440.Xfasm12_1511 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405440.Xfasm12_1511
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.66e-33
Family Chaperone J-domain 0.0000675
Further Details:      
 
Domain Number 2 Region: 124-199
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.57e-20
Family DnaJ/Hsp40 cysteine-rich domain 0.00006
Further Details:      
 
Domain Number 3 Region: 248-333
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.66e-20
Family HSP40/DnaJ peptide-binding domain 0.0023
Further Details:      
 
Domain Number 4 Region: 104-128,175-255
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.11e-19
Family HSP40/DnaJ peptide-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405440.Xfasm12_1511
Sequence length 368
Comment (Xylella fastidiosa M12)
Sequence
MSKRDYYQVLGVPRTASEDDLKKAYRRCAMKYHPDRNPGDAAAEAAFKECKEAYEVLADT
KKRKLYDTHGHAAFEHGVGGGNAPDMNDIFGDIFGNIFGGARASRRGADVGYMVELDLEE
AVAGVERQIQIPTLVECTHCNGSGSEDGHVETCGTCRGSGQVRIQRGIFAMQQTCPHCGG
RGVIIRNPCKVCNGAGRVEDHKTLSVKIPAGVDNGDRIRLSGEGEQGPDGVPPGDLYVEV
RVREHPIFQRDGDDLHCEVPVRISQAALGDIVRVATLDGEAEIRIPAETQSGKLFRLRGK
GVRSVRSRTEGDLYCRIVVETPVNLTAEQRKLLEQFEMTFAGEDARKHSPKSATFLDGVK
SFWDRMTS
Download sequence
Identical sequences A0A1R2D7C1 B0U3J7 Q3RDJ3
405440.Xfasm12_1511 WP_004085854.1.28558 WP_004085854.1.34418 WP_004085854.1.34606 WP_004085854.1.35854 WP_004085854.1.45638 WP_004085854.1.46267 WP_004085854.1.530 gi|170730623|ref|YP_001776056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]