SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405441.XfasM23_1752 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405441.XfasM23_1752
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000051
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 405441.XfasM23_1752
Sequence length 101
Comment (Xylella fastidiosa M23)
Sequence
MGSETKLHRDGNSLVLSGPLNRDAAIGLWSEIQAQSKSNGVSQLNLAGIKQLDSTGVALL
AEVMERIRVQGGSVPTIVAPPAGLKELLAAYRMSSDLQFQP
Download sequence
Identical sequences A0A060HBD7 A0A0E3CAA3 B2I878 Q87B02
WP_004089844.1.14680 WP_004089844.1.15411 WP_004089844.1.16295 WP_004089844.1.44032 WP_004089844.1.44309 WP_004089844.1.51832 WP_004089844.1.69964 WP_004089844.1.86577 WP_004089844.1.88863 WP_004089844.1.90029 gi|386083599|ref|YP_005999881.1| gi|28199535|ref|NP_779849.1| 183190.PD1658 405441.XfasM23_1752 gi|182682270|ref|YP_001830430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]