SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405531.BCG9842_B0256 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405531.BCG9842_B0256
Domain Number 1 Region: 114-361
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.68e-59
Family D-glucarate dehydratase-like 0.00000188
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.57e-33
Family Enolase N-terminal domain-like 0.0000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 405531.BCG9842_B0256
Sequence length 368
Comment (Bacillus cereus G9842)
Sequence
MEIKKATLYITEMPLVIPFAASYGTYEKRESIVIELEDTDGYIGFGEVVAFSEPWYTEET
VKTALHVLQDFLLPDLLKAEISHPNEVPGLFQHIKRNRMAKAGIEGAIWDLYAKRQKKSL
ATVLGGASPEIEVGVVIGINTIPVMLKQIEKYAEEGYERFKVKIKPEHDYELLKEIRKEF
PHIPLMADANSAYTLADTEKLKRLDEFQLMMIEQPLADYDFLDHAQLQKKIETPICLDES
IHSLEDARVAITLGSCRIVNIKPGRVGGLTESVQIHNYCMEHNIPVWCGGMVEMGISRAQ
NVALASLPNFTIPGDISASSRHWQRDIISPEVTLEGGKVMVPQSVDAEYEVDRGRLAEIT
KQRIVFER
Download sequence
Identical sequences A0A0Q0VA72 A0A0Q9FWB7 A0A0Q9GDM9 A0A161J2J6 A0A242Y119 A0A243LMT1 A0A2H3Q9K1 B7IM19
gi|434378020|ref|YP_006612664.1| 405531.BCG9842_B0256 gi|218900023|ref|YP_002448434.1| WP_000403313.1.101838 WP_000403313.1.26459 WP_000403313.1.3546 WP_000403313.1.38325 WP_000403313.1.48759 WP_000403313.1.52284 WP_000403313.1.60526 WP_000403313.1.61799 WP_000403313.1.64421 WP_000403313.1.83666 WP_000403313.1.87649 WP_000403313.1.87705 WP_000403313.1.92555 WP_000403313.1.97830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]