SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405531.BCG9842_B5703 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405531.BCG9842_B5703
Domain Number 1 Region: 138-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.4e-133
Family Enolase 0.00000000148
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.98e-61
Family Enolase N-terminal domain-like 0.000000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405531.BCG9842_B5703
Sequence length 431
Comment (Bacillus cereus G9842)
Sequence
MSTIIDVYAREVLDSRGNPTVEVEVYTESGAFGRAIVPSGASTGEHEAVELRDGDKSRYL
GKGVVNAVNNVNEIIAPEIAGFDVTDQAGIDRAMIELDGTPNKGKLGANAILGVSMAVAH
AAADFVGLPLYRYLGGFNAKQLPTPMMNIINGGSHADNNVDFQEFMILPVGAPTFKESIR
MGAEVFHALKAVLHDKGLNTAVGDEGGFAPNLGSNREALEVIIEAIEKAGYKAGENVFLG
MDVASSEFYNKETGKYDLAGEGRTGLTSAEMVDFYEELCKDFPIISIEDGLDENDWDGHK
LLTERIGDKVQLVGDDLFVTNTQKLAEGIEKGISNSILIKVNQIGTLTETFEAIEMAKRA
GYTAVVSHRSGETEDATIADIAVATNAGQIKTGSMSRTDRIAKYNQLLRIEDELGEIAVY
DGIKSFYNIKR
Download sequence
Identical sequences A0A023PCA5 A0A0A3VII0 A0A0D0RHR1 A0A0D0RLW7 A0A0E8TCZ4 A0A0F6FTA4 A0A0F6J6V0 A0A0G3E595 A0A0K0SFS4 A0A0Q9FBJ2 A0A0Q9FTL7 A0A0W7YF98 A0A135WNJ5 A0A160LGB3 A0A1C9C157 A0A1H6ALT2 A0A1I4KPY4 A0A1M7IP63 A0A1W2GBP6 A0A242YC85 A0A242YRA4 A0A243A7K5 A0A243AL50 A0A243DJ61 A0A243EL55 A0A243EN23 A0A243FNA1 A0A243J6M6 A0A243JR76 A0A243K292 A0A243LFG5 A0A243NP00 A0A2A2P0F7 A0A2A9HP63 A0A2C9YU89 A0A2H3QLW7 B5UPS5 B7IP20 C2P641 C2RFN9 C2WV17 C3DSM5 C3H8L7 G9QCX0 J3ZVV4 J7VMZ9 J7YPR6 J8F8B6 J8GRG1 J8MIL4 J8QIU5 J9CKW4 M1QUP4 N1LTX6 Q3EMP6 R8C4C1 R8E650 R8EB00 R8FA59 R8G4X8 R8G866 R8J1E2 R8JYR1 R8L2I3 R8P386 R8RAW6 R8XR11 S3IA87 V5MKS9 W8Z819
gi|218900256|ref|YP_002448667.1| gi|449092124|ref|YP_007424565.1| gi|384189214|ref|YP_005575110.1| 405531.BCG9842_B5703 gi|558683876|ref|YP_008822005.1| gi|434378253|ref|YP_006612897.1| gi|452201621|ref|YP_007481702.1| WP_000103951.1.100497 WP_000103951.1.101224 WP_000103951.1.101720 WP_000103951.1.101838 WP_000103951.1.10584 WP_000103951.1.10688 WP_000103951.1.10745 WP_000103951.1.10845 WP_000103951.1.1112 WP_000103951.1.11442 WP_000103951.1.11521 WP_000103951.1.11584 WP_000103951.1.12553 WP_000103951.1.12935 WP_000103951.1.13269 WP_000103951.1.13279 WP_000103951.1.13498 WP_000103951.1.13975 WP_000103951.1.17374 WP_000103951.1.17797 WP_000103951.1.18749 WP_000103951.1.19516 WP_000103951.1.2206 WP_000103951.1.22084 WP_000103951.1.22152 WP_000103951.1.2251 WP_000103951.1.23181 WP_000103951.1.23245 WP_000103951.1.23297 WP_000103951.1.23307 WP_000103951.1.23360 WP_000103951.1.24795 WP_000103951.1.26459 WP_000103951.1.26483 WP_000103951.1.26826 WP_000103951.1.26965 WP_000103951.1.27106 WP_000103951.1.27446 WP_000103951.1.27931 WP_000103951.1.28599 WP_000103951.1.29836 WP_000103951.1.29993 WP_000103951.1.31221 WP_000103951.1.3180 WP_000103951.1.3249 WP_000103951.1.33790 WP_000103951.1.34061 WP_000103951.1.34125 WP_000103951.1.34175 WP_000103951.1.34537 WP_000103951.1.34587 WP_000103951.1.3546 WP_000103951.1.35694 WP_000103951.1.35769 WP_000103951.1.36279 WP_000103951.1.37239 WP_000103951.1.38325 WP_000103951.1.38427 WP_000103951.1.38591 WP_000103951.1.3925 WP_000103951.1.39411 WP_000103951.1.39957 WP_000103951.1.40034 WP_000103951.1.40818 WP_000103951.1.41090 WP_000103951.1.41729 WP_000103951.1.4185 WP_000103951.1.41879 WP_000103951.1.42167 WP_000103951.1.42218 WP_000103951.1.42485 WP_000103951.1.43442 WP_000103951.1.4355 WP_000103951.1.43767 WP_000103951.1.43914 WP_000103951.1.44348 WP_000103951.1.44428 WP_000103951.1.4447 WP_000103951.1.44497 WP_000103951.1.45720 WP_000103951.1.47000 WP_000103951.1.47437 WP_000103951.1.48759 WP_000103951.1.49455 WP_000103951.1.49702 WP_000103951.1.50042 WP_000103951.1.50694 WP_000103951.1.51047 WP_000103951.1.51681 WP_000103951.1.52284 WP_000103951.1.54116 WP_000103951.1.54142 WP_000103951.1.54547 WP_000103951.1.54777 WP_000103951.1.5543 WP_000103951.1.57561 WP_000103951.1.57732 WP_000103951.1.58586 WP_000103951.1.58632 WP_000103951.1.58712 WP_000103951.1.5895 WP_000103951.1.59384 WP_000103951.1.60255 WP_000103951.1.60526 WP_000103951.1.61243 WP_000103951.1.61799 WP_000103951.1.61820 WP_000103951.1.61919 WP_000103951.1.62277 WP_000103951.1.6241 WP_000103951.1.62770 WP_000103951.1.63743 WP_000103951.1.63789 WP_000103951.1.63902 WP_000103951.1.64421 WP_000103951.1.64764 WP_000103951.1.674 WP_000103951.1.6743 WP_000103951.1.68007 WP_000103951.1.6816 WP_000103951.1.68346 WP_000103951.1.69347 WP_000103951.1.69501 WP_000103951.1.70108 WP_000103951.1.70181 WP_000103951.1.70667 WP_000103951.1.71242 WP_000103951.1.71652 WP_000103951.1.72484 WP_000103951.1.72752 WP_000103951.1.73594 WP_000103951.1.73638 WP_000103951.1.74302 WP_000103951.1.74372 WP_000103951.1.74651 WP_000103951.1.74832 WP_000103951.1.74857 WP_000103951.1.74863 WP_000103951.1.74976 WP_000103951.1.7534 WP_000103951.1.7544 WP_000103951.1.75891 WP_000103951.1.7593 WP_000103951.1.75942 WP_000103951.1.76804 WP_000103951.1.76883 WP_000103951.1.77402 WP_000103951.1.77567 WP_000103951.1.79549 WP_000103951.1.80622 WP_000103951.1.81000 WP_000103951.1.83666 WP_000103951.1.83694 WP_000103951.1.83977 WP_000103951.1.84541 WP_000103951.1.84775 WP_000103951.1.85667 WP_000103951.1.8577 WP_000103951.1.85928 WP_000103951.1.86619 WP_000103951.1.86763 WP_000103951.1.869 WP_000103951.1.87013 WP_000103951.1.87649 WP_000103951.1.87705 WP_000103951.1.87725 WP_000103951.1.87777 WP_000103951.1.87873 WP_000103951.1.88269 WP_000103951.1.89009 WP_000103951.1.89145 WP_000103951.1.89325 WP_000103951.1.89718 WP_000103951.1.90254 WP_000103951.1.90452 WP_000103951.1.90466 WP_000103951.1.90665 WP_000103951.1.91020 WP_000103951.1.91367 WP_000103951.1.92555 WP_000103951.1.93838 WP_000103951.1.94308 WP_000103951.1.94914 WP_000103951.1.9533 WP_000103951.1.96272 WP_000103951.1.9700 WP_000103951.1.9703 WP_000103951.1.97082 WP_000103951.1.97327 WP_000103951.1.97561 WP_000103951.1.97816 WP_000103951.1.97821 WP_000103951.1.97830 WP_000103951.1.97993 WP_000103951.1.98053 WP_000103951.1.98315 WP_000103951.1.9860 gi|402563333|ref|YP_006606057.1| gi|410677543|ref|YP_006929914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]