SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405532.BCB4264_A2709 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405532.BCB4264_A2709
Domain Number 1 Region: 161-253
Classification Level Classification E-value
Superfamily Homing endonucleases 7.75e-16
Family Group I mobile intron endonuclease 0.078
Further Details:      
 
Domain Number 2 Region: 76-145
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000013
Family Group I mobile intron endonuclease 0.038
Further Details:      
 
Weak hits

Sequence:  405532.BCB4264_A2709
Domain Number - Region: 16-46
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0068
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 405532.BCB4264_A2709
Sequence length 331
Comment (Bacillus cereus B4264)
Sequence
MQIERKKNSKCKLSKSEIIHLYAEGKSTSEIAMLANVSARYIRMVLSDNNVPRRAIGSWK
RKYDITEDYFKTWSNNMAYILGFIAADGVIQKENQCVSISQKENYILEDIKQELNTNQPL
YLNKKTDVYMLNINSKVIKDDLMNIHGIMPCKSFNIEFPLVPEEYLHHFVCGYFDGDGYV
KYETYTVSFVGGSYNFMNSLNQVLQNHNLTSYLINQNTHYRVILSGRKSIQLFSKWIYKD
KGIYLHRKYEVFQKESLSLDQLQDRKLKQTQTAVKQRKQNFLEEYMKNKCNATTCSNLEI
SESAFKRWLKNDNQFKRDYEKINLTMSTSDN
Download sequence
Identical sequences B7H831
gi|218232687|ref|YP_002367417.1| WP_001165408.1.76086 405532.BCB4264_A2709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]