SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405532.BCB4264_A3404 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405532.BCB4264_A3404
Domain Number 1 Region: 438-544
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.53e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405532.BCB4264_A3404
Sequence length 587
Comment (Bacillus cereus B4264)
Sequence
MRKLFTGRFEGYSLAHFQKDLLSGMIVGVVAIPLAMSFAIASGVKPEYGIYTTCIAGILI
SLFGGSKYQIGGPTGAFVPILLGVVITYGYENLLLAGLLAGIILCLMGIFKLGSLIKFIP
RPVTIGFTSGIAVIIFTGQIASFLGLTGIKKHEEFLANLKELFTHISTTNFYSVITALIC
FFVILITPKILPKVPGSLVGVVISTVIATVFFSGYVPTIGTAYGTIPNTLPHFDIPEITL
ERIKQLIGPAFVIAMLGGIESLLSAVVADGMTNSKHNSNKELIGQGIANIVTPLFGGIPA
TGAIARTATNIKSGAVSPMAGVIHGGFVLFTLLLLAPYASHIPLASMAPILMVVAWNMSE
QKHFYHILKMKTGDSLVLLVTFLLTVFTSLTTAVEIGLILAIILFTKRMSNMLVISKVLP
DHTKRNEKLLPHVVNKAHDCPQISIYTIEGPLFFGAAQTFEQNILATIHYKPNVLILRMG
KVPFIDTTGESYFRNIVQHFKKQGGVLLISGIQSELKANLDKNGLYAEIGEENFFNHTGE
AINCALGHLNTKKCIGCKHFAFHECTGLSQQSQEINTIKNKENALDF
Download sequence
Identical sequences A0A0K0SAS3 A0A242YLD5 A0A243NNW9 A0A2A9RVQ3 B5ULG8 B7H6D4 C2P1A2 C2RAS9 J7Z520
gi|218233633|ref|YP_002368108.1| 405532.BCB4264_A3404 WP_001228488.1.10055 WP_001228488.1.101224 WP_001228488.1.2251 WP_001228488.1.26483 WP_001228488.1.31221 WP_001228488.1.47000 WP_001228488.1.47437 WP_001228488.1.54142 WP_001228488.1.6816 WP_001228488.1.71242 WP_001228488.1.72484 WP_001228488.1.76086 WP_001228488.1.76804 WP_001228488.1.77567 WP_001228488.1.90466 WP_001228488.1.97082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]