SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405532.BCB4264_A3873 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405532.BCB4264_A3873
Domain Number 1 Region: 196-458
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.77e-73
Family PFOR Pyr module 0.018
Further Details:      
 
Domain Number 2 Region: 1-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.32e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.003
Further Details:      
 
Domain Number 3 Region: 468-576
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.19e-24
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405532.BCB4264_A3873
Sequence length 585
Comment (Bacillus cereus B4264)
Sequence
MISQLSWKVGGQQGEGIESTGEIFCIALNRLGYYLYGYRHFSSRIKGGHTNNKIRVSTTE
VRAISDDLDILIAFDQETIDFNFHELRPGGIVVADAKFNPTIPDNTDVNLYVIPFTDIAS
ELGTSLMKNMVAVGASSAVLGLDETAYLDVVEEIFGRKGEQVVQKNMDAIKRGSQYMKEL
LGEKVNMMQLEKADGKKRMFMIGNDAIAFGAVAGGARFMSAYPITPASEIMEYLIKKLPK
VGGTVIQTEDEIAACTMAIGANYAGVRTLTASAGPGLSLMMEAIGLAGITETPLVIVDTQ
RGGPSTGLPTKQEQSDLMAMIYGTHGEIPKIVMAPSTVEEAFYDIVEAFNLSEEYQVPVI
FLTDLQLSLGKQTVEPLKLDKVEIRRGKLDLEVELPERENKAYFKRYEVTEDGVSPRVLP
GMKNGVHHVTGVEHDETGKPSESAINRKDQMDKRFRKMENLKFNTPVYKNVKHEEADVLL
VGFNSTRGAIEEAMTRLEQEGMKVNHAHVRLIHPFPTAEIDPLVKKAKRVVVVENNATGQ
LANIMKMNLGNGEKISSLLKYDGNPFLPKEIYNECKKGVVLNGNI
Download sequence
Identical sequences A0A0D1QX75 A0A0G4CXB0 A0A0J6Z0F7 A0A0T8H6Q1 A0A1M6LX72 A0A1Y0TJW6 A0A229MD06 A0A243DE50 A0A243DS23 A0A243KZW5 A0A243MDP1 B7HDP9 C2RBX0 C2T4M8 C2UHP4 C3E718 J8I302 J8LEQ1 J8MHR2 J8MQG3 J8N682 N1LUT7 Q81A21 R8E7K7 R8H1X6 R8TEQ4
gi|218236037|ref|YP_002368577.1| NP_833497.1.86172 WP_000625418.1.100082 WP_000625418.1.10055 WP_000625418.1.100912 WP_000625418.1.10584 WP_000625418.1.1354 WP_000625418.1.14006 WP_000625418.1.14039 WP_000625418.1.14174 WP_000625418.1.14176 WP_000625418.1.18914 WP_000625418.1.19438 WP_000625418.1.20208 WP_000625418.1.20651 WP_000625418.1.21055 WP_000625418.1.22699 WP_000625418.1.23540 WP_000625418.1.23652 WP_000625418.1.24680 WP_000625418.1.25290 WP_000625418.1.25599 WP_000625418.1.26637 WP_000625418.1.26826 WP_000625418.1.28237 WP_000625418.1.32784 WP_000625418.1.32927 WP_000625418.1.33201 WP_000625418.1.33717 WP_000625418.1.36221 WP_000625418.1.3798 WP_000625418.1.38345 WP_000625418.1.39411 WP_000625418.1.39957 WP_000625418.1.41464 WP_000625418.1.41518 WP_000625418.1.44956 WP_000625418.1.46326 WP_000625418.1.51072 WP_000625418.1.54240 WP_000625418.1.54736 WP_000625418.1.55116 WP_000625418.1.56320 WP_000625418.1.58822 WP_000625418.1.59058 WP_000625418.1.59997 WP_000625418.1.60153 WP_000625418.1.60334 WP_000625418.1.6304 WP_000625418.1.63902 WP_000625418.1.64282 WP_000625418.1.64568 WP_000625418.1.67001 WP_000625418.1.67873 WP_000625418.1.67912 WP_000625418.1.6846 WP_000625418.1.68562 WP_000625418.1.71114 WP_000625418.1.73396 WP_000625418.1.73457 WP_000625418.1.73594 WP_000625418.1.73790 WP_000625418.1.7593 WP_000625418.1.76086 WP_000625418.1.76155 WP_000625418.1.76804 WP_000625418.1.76902 WP_000625418.1.80126 WP_000625418.1.80649 WP_000625418.1.81773 WP_000625418.1.85592 WP_000625418.1.86619 WP_000625418.1.86637 WP_000625418.1.88154 WP_000625418.1.88200 WP_000625418.1.90352 WP_000625418.1.93683 WP_000625418.1.95576 WP_000625418.1.96287 WP_000625418.1.96437 WP_000625418.1.97262 WP_000625418.1.97670 WP_000625418.1.97842 WP_000625418.1.98604 WP_000625418.1.99212 gi|296504273|ref|YP_003665973.1| 226900.BC3774 405532.BCB4264_A3873 gi|30021866|ref|NP_833497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]