SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405534.BCAH187_A1157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405534.BCAH187_A1157
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.83e-25
Family Anti-sigma factor antagonist SpoIIaa 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405534.BCAH187_A1157
Sequence length 112
Comment (Bacillus cereus AH187)
Sequence
MMNLGINILQNDVGYTVQLNGEIDAYTASDLKNKIMPIAGEKEVHIVVDFTEVEYMDSTG
LGVFIALLKAVKKNNGKLEFIGVSKRLKRLFDITGLTEILNLNSDFEKVERR
Download sequence
Identical sequences A0A1Y6AK89 B7HYQ5 C2RZZ3
405534.BCAH187_A1157 gi|217958579|ref|YP_002337127.1| WP_001993064.1.13299 WP_001993064.1.46864 WP_001993064.1.6753 WP_001993064.1.91615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]