SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405534.BCAH187_A2173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405534.BCAH187_A2173
Domain Number 1 Region: 79-139
Classification Level Classification E-value
Superfamily NfeD domain-like 3.92e-16
Family NfeD domain-like 0.0026
Further Details:      
 
Weak hits

Sequence:  405534.BCAH187_A2173
Domain Number - Region: 10-60
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0249
Family Clc chloride channel 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 405534.BCAH187_A2173
Sequence length 142
Comment (Bacillus cereus AH187)
Sequence
MAAWVIWFIIAGILFIAEMLSITFYMLWLGIGAVVGGLIALFVPEALLLQVVAGAIVSLT
LTFFTKRISKNFREAKGFTDTVDMLAGKKGIVMQAITNEANGIVKVDGDTWTAIADDPID
AGEKVIVIKRHSTILQVKKESE
Download sequence
Identical sequences A0A0F5RWQ0 A0A136C3V6 A0A1J9YF97 A0A1J9ZCV1 A0A229MSL2 B7HP01 B9IYL5 C2MJX7 C2S2W7 Q739J5
WP_000741991.1.101550 WP_000741991.1.10762 WP_000741991.1.11044 WP_000741991.1.11060 WP_000741991.1.12751 WP_000741991.1.13024 WP_000741991.1.13299 WP_000741991.1.16199 WP_000741991.1.17408 WP_000741991.1.18840 WP_000741991.1.20687 WP_000741991.1.21172 WP_000741991.1.21643 WP_000741991.1.23100 WP_000741991.1.24184 WP_000741991.1.24377 WP_000741991.1.24759 WP_000741991.1.26499 WP_000741991.1.27334 WP_000741991.1.29209 WP_000741991.1.31685 WP_000741991.1.32522 WP_000741991.1.33045 WP_000741991.1.33061 WP_000741991.1.3318 WP_000741991.1.35255 WP_000741991.1.3615 WP_000741991.1.37093 WP_000741991.1.37990 WP_000741991.1.38425 WP_000741991.1.39001 WP_000741991.1.41976 WP_000741991.1.43762 WP_000741991.1.44463 WP_000741991.1.45089 WP_000741991.1.46244 WP_000741991.1.46746 WP_000741991.1.47097 WP_000741991.1.48010 WP_000741991.1.48164 WP_000741991.1.48311 WP_000741991.1.48599 WP_000741991.1.49056 WP_000741991.1.49428 WP_000741991.1.49802 WP_000741991.1.50316 WP_000741991.1.50514 WP_000741991.1.50770 WP_000741991.1.51087 WP_000741991.1.51656 WP_000741991.1.52756 WP_000741991.1.54775 WP_000741991.1.54782 WP_000741991.1.55057 WP_000741991.1.56055 WP_000741991.1.57203 WP_000741991.1.57565 WP_000741991.1.57815 WP_000741991.1.57859 WP_000741991.1.58328 WP_000741991.1.58814 WP_000741991.1.59052 WP_000741991.1.59773 WP_000741991.1.60274 WP_000741991.1.61944 WP_000741991.1.64377 WP_000741991.1.64706 WP_000741991.1.65758 WP_000741991.1.69970 WP_000741991.1.70645 WP_000741991.1.72514 WP_000741991.1.77576 WP_000741991.1.77690 WP_000741991.1.77902 WP_000741991.1.79043 WP_000741991.1.79252 WP_000741991.1.79658 WP_000741991.1.81088 WP_000741991.1.82421 WP_000741991.1.82533 WP_000741991.1.82986 WP_000741991.1.83070 WP_000741991.1.84337 WP_000741991.1.8923 WP_000741991.1.90671 WP_000741991.1.91080 WP_000741991.1.91404 WP_000741991.1.91615 WP_000741991.1.92347 WP_000741991.1.93932 WP_000741991.1.95457 WP_000741991.1.95484 WP_000741991.1.97617 WP_000741991.1.99266 222523.BCE_2145 361100.BCQ_2056 405534.BCAH187_A2173 gi|217959574|ref|YP_002338126.1| gi|222095716|ref|YP_002529773.1| gi|375284083|ref|YP_005104521.1| gi|42781211|ref|NP_978458.1| GO.2734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]