SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405535.BCAH820_2774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  405535.BCAH820_2774
Domain Number - Region: 94-156
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.06
Family D-glucarate dehydratase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405535.BCAH820_2774
Sequence length 218
Comment (Bacillus cereus AH820)
Sequence
MKYFNKDWYKEMQVSGFLNFSETVEEWEEMLRESEKIGMDYKQSLREDAEEKKEDLLKFL
PKSLHPYIHDNTINSEYPSEKLKKLMLEWTEDYEKRMDDLEQAYKDNYNSIKERLAQNVV
QLYEYSLHDSQVTSVERRSKDTIIITLDCSGTFNEFDKLKVTFTGVSKCSIPENFEGAWW
LCHEIDLAEDGVELGVLFDCPFEEVMICAKNVLLEIDN
Download sequence
Identical sequences A0A242VXH5 B7JRN5
gi|218903890|ref|YP_002451724.1| 405535.BCAH820_2774 WP_000873334.1.33536 WP_000873334.1.55968 WP_000873334.1.67239 WP_000873334.1.7545 WP_000873334.1.85901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]