SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405535.BCAH820_5220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405535.BCAH820_5220
Domain Number 1 Region: 138-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.4e-133
Family Enolase 0.00000000148
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.8e-61
Family Enolase N-terminal domain-like 0.000000999
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405535.BCAH820_5220
Sequence length 431
Comment (Bacillus cereus AH820)
Sequence
MSTIIDVYAREVLDSRGNPTVEVEVYTESGAFGRAIVPSGASTGEHEAVELRDGDKSRYL
GKGVMNAVNNVNEAIAPEIVGFDVTDQAGIDRAMIELDGTPNKGKLGANAILGVSMAVAH
AAADFVGLPLYRYLGGFNAKQLPTPMMNIINGGSHADNNVDFQEFMILPVGAPTFKESIR
MGAEVFHALKAVLHDKGLNTAVGDEGGFAPNLGSNREALEVIIEAIEKAGYKAGENVFLG
MDVASSEFYNKETGKYDLAGEGRTGLTSAEMVDFYEELCKDFPIISIEDGLDENDWDGHK
LLTERIGDKVQLVGDDLFVTNTQKLAEGIEKGISNSILIKVNQIGTLTETFEAIEMAKRA
GYTAVVSHRSGETEDATIADIAVATNAGQIKTGSMSRTDRIAKYNQLLRIEDELGEIAVY
DGIKSFYNIKR
Download sequence
Identical sequences A0A068NDD7 A0A0B6BGV2 A0A0F7R9V8 A0A0K6MY10 A0A0U0GFA4 A0A1H4F1L5 A0A1J9UEE4 A0A1K0BTY0 A0A1X6QE28 A0A242WCD6 A0A242YAU3 A0A243B8P8 A0A243CLD1 A0A243IK66 A0A2B4FAX2 A0RKS3 B3Z8Z7 B3ZR92 B7JFG3 C1EZA0 C2NQ83 C2QJK0 C2R0M3 C2W1D5 C2ZF48 C3CAA4 C3GAJ1 C3GR31 C3LDI0 C3P0A3 D8H2L1 J8RHG9 Q6HBF3 Q81X78 R8HE43
gi|49187971|ref|YP_031224.1| NP_847538.1.87267 WP_000103949.1.100059 WP_000103949.1.100214 WP_000103949.1.100409 WP_000103949.1.100595 WP_000103949.1.101931 WP_000103949.1.10208 WP_000103949.1.11387 WP_000103949.1.11427 WP_000103949.1.11609 WP_000103949.1.11676 WP_000103949.1.13115 WP_000103949.1.13221 WP_000103949.1.13233 WP_000103949.1.13820 WP_000103949.1.14721 WP_000103949.1.14855 WP_000103949.1.14882 WP_000103949.1.15163 WP_000103949.1.15460 WP_000103949.1.15569 WP_000103949.1.16156 WP_000103949.1.16355 WP_000103949.1.16997 WP_000103949.1.17146 WP_000103949.1.17424 WP_000103949.1.18976 WP_000103949.1.19258 WP_000103949.1.19435 WP_000103949.1.19445 WP_000103949.1.195 WP_000103949.1.20390 WP_000103949.1.20680 WP_000103949.1.20865 WP_000103949.1.20973 WP_000103949.1.21258 WP_000103949.1.21776 WP_000103949.1.22865 WP_000103949.1.22991 WP_000103949.1.23269 WP_000103949.1.23615 WP_000103949.1.23873 WP_000103949.1.2419 WP_000103949.1.24334 WP_000103949.1.24556 WP_000103949.1.24608 WP_000103949.1.24676 WP_000103949.1.2521 WP_000103949.1.25316 WP_000103949.1.2569 WP_000103949.1.25716 WP_000103949.1.25752 WP_000103949.1.26000 WP_000103949.1.2618 WP_000103949.1.26665 WP_000103949.1.26721 WP_000103949.1.27644 WP_000103949.1.28427 WP_000103949.1.28729 WP_000103949.1.29101 WP_000103949.1.29787 WP_000103949.1.30110 WP_000103949.1.30216 WP_000103949.1.3026 WP_000103949.1.31490 WP_000103949.1.3236 WP_000103949.1.32576 WP_000103949.1.33175 WP_000103949.1.33338 WP_000103949.1.33367 WP_000103949.1.33536 WP_000103949.1.33740 WP_000103949.1.33828 WP_000103949.1.33876 WP_000103949.1.34158 WP_000103949.1.35026 WP_000103949.1.35153 WP_000103949.1.35518 WP_000103949.1.3561 WP_000103949.1.35684 WP_000103949.1.35886 WP_000103949.1.3612 WP_000103949.1.36305 WP_000103949.1.36763 WP_000103949.1.3699 WP_000103949.1.37626 WP_000103949.1.38036 WP_000103949.1.38517 WP_000103949.1.39781 WP_000103949.1.40839 WP_000103949.1.41165 WP_000103949.1.41365 WP_000103949.1.41675 WP_000103949.1.42217 WP_000103949.1.43104 WP_000103949.1.4439 WP_000103949.1.44483 WP_000103949.1.45305 WP_000103949.1.45385 WP_000103949.1.46236 WP_000103949.1.46476 WP_000103949.1.4649 WP_000103949.1.46549 WP_000103949.1.46699 WP_000103949.1.47145 WP_000103949.1.4763 WP_000103949.1.47644 WP_000103949.1.47798 WP_000103949.1.4865 WP_000103949.1.49831 WP_000103949.1.51749 WP_000103949.1.52494 WP_000103949.1.52794 WP_000103949.1.53137 WP_000103949.1.53493 WP_000103949.1.53621 WP_000103949.1.53683 WP_000103949.1.53879 WP_000103949.1.54117 WP_000103949.1.55811 WP_000103949.1.55958 WP_000103949.1.55968 WP_000103949.1.56042 WP_000103949.1.56176 WP_000103949.1.56270 WP_000103949.1.56318 WP_000103949.1.56580 WP_000103949.1.58160 WP_000103949.1.59095 WP_000103949.1.59173 WP_000103949.1.59310 WP_000103949.1.59575 WP_000103949.1.59978 WP_000103949.1.6 WP_000103949.1.60402 WP_000103949.1.60841 WP_000103949.1.61126 WP_000103949.1.61213 WP_000103949.1.62107 WP_000103949.1.62300 WP_000103949.1.63560 WP_000103949.1.63611 WP_000103949.1.64491 WP_000103949.1.66331 WP_000103949.1.66357 WP_000103949.1.67108 WP_000103949.1.67239 WP_000103949.1.68550 WP_000103949.1.68607 WP_000103949.1.69203 WP_000103949.1.69323 WP_000103949.1.69822 WP_000103949.1.69894 WP_000103949.1.70065 WP_000103949.1.7096 WP_000103949.1.70996 WP_000103949.1.71441 WP_000103949.1.71895 WP_000103949.1.72704 WP_000103949.1.73325 WP_000103949.1.73329 WP_000103949.1.73952 WP_000103949.1.74226 WP_000103949.1.74337 WP_000103949.1.74538 WP_000103949.1.7545 WP_000103949.1.75499 WP_000103949.1.75870 WP_000103949.1.76125 WP_000103949.1.76783 WP_000103949.1.77668 WP_000103949.1.77824 WP_000103949.1.782 WP_000103949.1.7856 WP_000103949.1.78644 WP_000103949.1.79315 WP_000103949.1.79584 WP_000103949.1.80439 WP_000103949.1.80695 WP_000103949.1.81799 WP_000103949.1.82289 WP_000103949.1.83228 WP_000103949.1.83938 WP_000103949.1.83951 WP_000103949.1.84045 WP_000103949.1.84422 WP_000103949.1.85689 WP_000103949.1.85901 WP_000103949.1.86119 WP_000103949.1.86140 WP_000103949.1.86239 WP_000103949.1.86288 WP_000103949.1.8698 WP_000103949.1.8825 WP_000103949.1.88431 WP_000103949.1.88641 WP_000103949.1.90155 WP_000103949.1.90596 WP_000103949.1.90883 WP_000103949.1.92686 WP_000103949.1.9269 WP_000103949.1.93271 WP_000103949.1.93744 WP_000103949.1.93893 WP_000103949.1.93927 WP_000103949.1.94237 WP_000103949.1.94322 WP_000103949.1.94373 WP_000103949.1.94784 WP_000103949.1.95308 WP_000103949.1.96934 WP_000103949.1.97149 WP_000103949.1.97781 WP_000103949.1.97861 WP_000103949.1.98216 WP_000103949.1.98519 WP_000103949.1.98557 WP_000103949.1.98571 WP_000103949.1.99445 WP_000103949.1.99454 WP_000103949.1.99994 YP_031224.1.16718 YP_039123.1.62562 gi|218906308|ref|YP_002454142.1| gi|301056594|ref|YP_003794805.1| gi|49481799|ref|YP_039123.1| gi|118480172|ref|YP_897323.1| gi|229600814|ref|YP_002869355.1| gi|47530674|ref|YP_022023.1| gi|30265161|ref|NP_847538.1| OPTIC6697 198094.BA_5364 260799.BAS4985 261594.GBAA5364 281309.BT9727_4814 405535.BCAH820_5220 412694.BALH_4627 568206.BAMEG_5417 572264.BCA_5246 592021.BAA_5394 gi|376269016|ref|YP_005121728.1| gi|227817894|ref|YP_002817903.1| gi|225867081|ref|YP_002752459.1| gi|386738988|ref|YP_006212169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]