SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405948.SACE_2494 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  405948.SACE_2494
Domain Number - Region: 80-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000112
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 405948.SACE_2494
Sequence length 143
Comment (Saccharopolyspora erythraea NRRL 2338)
Sequence
MDAWLVWLLLAVALGVAEIFTLTAALGLLGGAALITAGLAALGVPLPVQLVVFALASAAS
VLLVRPVAARHMVGPQTQRFGVDALIGKSAYTVREVTAWDGRIRLDGEEWTAHSFDETVV
IPEGTTVDVLQISGSTAIVYPRE
Download sequence
Identical sequences A4FCL2
gi|134099051|ref|YP_001104712.1| WP_009947245.1.17192 WP_009947245.1.58781 WP_009947245.1.76288 405948.SACE_2494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]