SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405948.SACE_3782 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405948.SACE_3782
Domain Number 1 Region: 77-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000981
Family NfeD domain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405948.SACE_3782
Sequence length 143
Comment (Saccharopolyspora erythraea NRRL 2338)
Sequence
MVPALLWLIAGVVLIAAEVLSGDFVLVMLGAGALAAAGASALGVPLGLDAAVFAALSLGL
IFLARPALKRRMRVEHELKTNVDALVGHKAVVESTVDAHGGRVRIGGELWSARAFDETQV
MHSGQTVTVMEISGATAVVWAEP
Download sequence
Identical sequences A4FG78
gi|134100317|ref|YP_001105978.1| 405948.SACE_3782 WP_009949732.1.17192 WP_009949732.1.58781 WP_009949732.1.76288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]