SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405948.SACE_5057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405948.SACE_5057
Domain Number 1 Region: 98-396
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.54e-72
Family D-glucarate dehydratase-like 0.00028
Further Details:      
 
Domain Number 2 Region: 10-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.79e-33
Family Enolase N-terminal domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405948.SACE_5057
Sequence length 412
Comment (Saccharopolyspora erythraea NRRL 2338)
Sequence
MLIERADVIVTSPGRNFVTLKITTDDGVVGYGDGTLNGRELAVVSYLTDHVAPLLLGRDA
HAIEDTWQYLYRGAYWRRGPVTMAAIAAVDTALWDIKAKVAGLPLYQMLGGASRERCLVY
GHASGKDIPELFDSVREHLEEGFRAIRVQTGVPGLDSVYGVASSAAASLGDDTRYDYEPA
RRSALPAEETWDTRAYLRHVPSVFEAVRGEFGEDIALLHDAHHRLTPIQAAKLGKSLEPY
DLFWLEDVTPAENQEALRWVRHHTTTPLAIGEVFNSVWDYQHLIREQLIDYVRSPITHAG
GITSVRRIMDYAAMYQVKSGMHGPTDVSPVGLAAAVHLGLALHNFGIQEYMVHSEQTRSV
FGPTYEFALGGLRPSEEPGLGIHFDDDLAAKYPYERAYLPVNRLQDGTVHDW
Download sequence
Identical sequences A4FJU2
405948.SACE_5057 WP_009949934.1.58781 WP_009949934.1.76288 gi|134101581|ref|YP_001107242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]