SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405948.SACE_5860 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405948.SACE_5860
Domain Number 1 Region: 134-388
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.83e-62
Family D-glucarate dehydratase-like 0.00049
Further Details:      
 
Domain Number 2 Region: 42-151
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.24e-27
Family Enolase N-terminal domain-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405948.SACE_5860
Sequence length 390
Comment (Saccharopolyspora erythraea NRRL 2338)
Sequence
MKIRQVRALTVTGGGADYHDQAEDHWIDDHVATPMAKYPEYRASRQAFGINVLGTLVVEV
EAEDGTVGVGVTTAGEPGAYIVEKHLARFVEGASVTDVEKIWDQMFNATLYYGRKGLVLN
AISAVDLALYDLLGKIRQEPVYALLGGPVRDELQCYATTGRPDVAKELGFLGGKMTLQHG
PAEGVEGLHANIERLRKMREQVGPDFWLMFDCWMALDVEYATRLAHAAAEYDLKWLEEAL
IPDDYWGYGELRRRMPSTMLMTTGEHEHTRYGFRLLLEMGRPDIIQPDVNWCGGITELIK
ISALADAHGAMVVPHGSSVYSYHFVITRHNSPFTEFLMMHPQATEVVPMFSPLLLDEPVP
VGGRLRLPETPGFGVRLNPEVELRRPYDHD
Download sequence
Identical sequences A0A2A9JHH7 A4FLW9
WP_009943127.1.17192 WP_009943127.1.58781 WP_009943127.1.76288 gi|134102308|ref|YP_001107969.1| 405948.SACE_5860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]