SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405948.SACE_6327 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405948.SACE_6327
Domain Number 1 Region: 101-311
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.01e-53
Family D-glucarate dehydratase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 6-96
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.00000000000438
Family Enolase N-terminal domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405948.SACE_6327
Sequence length 323
Comment (Saccharopolyspora erythraea NRRL 2338)
Sequence
MHERGAVTLEIEHDGVVGFGEVVTSVFYDLDVARIEALLESNRDVIEGSSDPERLLASLP
DGPLAADAPGVLAAVDAALHDLVAKLRGVAVHELVGAPRPERVPTARTIGITSLERSAET
AESLAARGFELIKVKVGAEEQPELERIAAIRRAAPGARLLLDPNGAWQPEQAVRMLEAAH
RHGVEAVEQPIPAGTPHLLAEVARRSPVPVIADEDAAGLDEVRALGDSVRGVNVKLAKCG
GIRAAMRIVEAARDRGVEVMLGCLVASSLGIAPAVHLAGLARWVDLDGHLLLAHDPWTGI
GGEDGVLRVVGQAGLCVRRAGET
Download sequence
Identical sequences A4FN73
WP_011875017.1.17192 WP_011875017.1.58781 WP_011875017.1.76288 NYSGXRC-9758a gi|134102762|ref|YP_001108423.1| 405948.SACE_6327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]