SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405955.APECO1_2506 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405955.APECO1_2506
Domain Number 1 Region: 118-408
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.03e-78
Family D-glucarate dehydratase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 21-132
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.31e-32
Family Enolase N-terminal domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405955.APECO1_2506
Sequence length 424
Comment (Escherichia coli APEC O1)
Sequence
MVVGVKLSLKCLFTIQEIAIMKIIAVDVFVTCPGRNFVTLKITTESGLCGLGDATLNGRE
LSVASYLKDHLCPQLIGRDASRIEDIWQFFYKGAYWRRGPVTMSAISAIDMALWDIKAKA
ANMPLYQLLGGASREGVMVYCHTTGRTIDEVLEDYAKHQQMGFKAIRVQCGVPGMQTTYG
LAKGKGLAYEPATKGLWPEEQLWSSEKYLDFTPKLFEAVRNKFGFNEHLLHDMHHRLTPI
EAARFGRSIEDYRLFWMEDPTPAENQECFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQL
IDYIRTTITHAGGITGMRRIVDFASLYQVRTGSHGPSDLSPVCHAAALHFDLWVPNFGVQ
EYMGYSEQMFEVFPHSWRFDEGYMHPGDEPGLGISFDEKLAAKYPYDPAYLPVARLEDGT
LWNW
Download sequence
Identical sequences A0A0H2Z514 A0A1X3K2J8
405955.APECO1_2506 gi|117626230|ref|YP_859553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]