SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 405955.APECO1_551 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405955.APECO1_551
Domain Number 1 Region: 794-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.39e-118
Family PFOR PP module 0.0000000358
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.44e-76
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000128
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.18e-72
Family PFOR Pyr module 0.0000000907
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00002
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.7e-23
Family Ferredoxin domains from multidomain proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 405955.APECO1_551
Sequence length 1174
Comment (Escherichia coli APEC O1)
Sequence
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALISHIATLKSRVPFIHFFDGFRTSHEINKIV
PLADDTILELMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
QAMNDFAAATGRHYQPFEYYGHPQAERVIILMGSAIGTCEEVVDELLTRGEKVGVLKVRL
YRPFSAKHLLQALPGSVRNVAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRVI
GGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDDVTNLSLPLPENTLPNSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEQPIRSAYL
ISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSAAEVWSRLPQEVQAVLNQKKARF
YVINAAKIARECGLAARINTVMQMAFFHLTQILPGDSALAELQGAIAKSYSSKGQDLVER
NWQALALARESVEEVPLQPVNPHSANRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNHCVAACPHSAIRAKVVPPEAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KINYDFFLNLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRVRVLRL
LDQFADKIPTELLTALKSDATPEVRRAQVAALRQQLNDVAEAHELLRDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSEALEETLLHEQRFRRLNSQQP
EVAEQLWKDAAADLQKRYDFLAQMAGKAEKSNTD
Download sequence
Identical sequences A0A0E2L6U6 A0A0H2YYW4 A0A1X3KAD1 A0A2G8ZRS6 B7MM26 Q1RC17
gi|218558334|ref|YP_002391247.1| gi|386599250|ref|YP_006100756.1| 364106.UTI89_C1619 405955.APECO1_551 585035.ECS88_1493 WP_000628251.1.100735 WP_000628251.1.100738 WP_000628251.1.100898 WP_000628251.1.101926 WP_000628251.1.102144 WP_000628251.1.10326 WP_000628251.1.10492 WP_000628251.1.10697 WP_000628251.1.11057 WP_000628251.1.11217 WP_000628251.1.11250 WP_000628251.1.11531 WP_000628251.1.12009 WP_000628251.1.12010 WP_000628251.1.12076 WP_000628251.1.12761 WP_000628251.1.1323 WP_000628251.1.15857 WP_000628251.1.15984 WP_000628251.1.1802 WP_000628251.1.19379 WP_000628251.1.1987 WP_000628251.1.2027 WP_000628251.1.20709 WP_000628251.1.20761 WP_000628251.1.21634 WP_000628251.1.21714 WP_000628251.1.2245 WP_000628251.1.22549 WP_000628251.1.23230 WP_000628251.1.23962 WP_000628251.1.24169 WP_000628251.1.25021 WP_000628251.1.25079 WP_000628251.1.25174 WP_000628251.1.25270 WP_000628251.1.2606 WP_000628251.1.26627 WP_000628251.1.26659 WP_000628251.1.26782 WP_000628251.1.27932 WP_000628251.1.28051 WP_000628251.1.285 WP_000628251.1.28842 WP_000628251.1.29513 WP_000628251.1.29820 WP_000628251.1.30269 WP_000628251.1.30570 WP_000628251.1.30896 WP_000628251.1.30905 WP_000628251.1.31559 WP_000628251.1.31823 WP_000628251.1.31863 WP_000628251.1.33217 WP_000628251.1.33563 WP_000628251.1.34303 WP_000628251.1.3432 WP_000628251.1.34835 WP_000628251.1.34913 WP_000628251.1.36132 WP_000628251.1.36158 WP_000628251.1.365 WP_000628251.1.36545 WP_000628251.1.36799 WP_000628251.1.37313 WP_000628251.1.37736 WP_000628251.1.38293 WP_000628251.1.39327 WP_000628251.1.40211 WP_000628251.1.41847 WP_000628251.1.41923 WP_000628251.1.42350 WP_000628251.1.42413 WP_000628251.1.42670 WP_000628251.1.42804 WP_000628251.1.43422 WP_000628251.1.43733 WP_000628251.1.43803 WP_000628251.1.440 WP_000628251.1.44251 WP_000628251.1.44460 WP_000628251.1.4541 WP_000628251.1.45990 WP_000628251.1.46833 WP_000628251.1.47039 WP_000628251.1.48121 WP_000628251.1.48620 WP_000628251.1.48629 WP_000628251.1.49061 WP_000628251.1.49522 WP_000628251.1.49662 WP_000628251.1.49675 WP_000628251.1.49794 WP_000628251.1.4985 WP_000628251.1.50887 WP_000628251.1.518 WP_000628251.1.51896 WP_000628251.1.51944 WP_000628251.1.5199 WP_000628251.1.52363 WP_000628251.1.53410 WP_000628251.1.53587 WP_000628251.1.54102 WP_000628251.1.54388 WP_000628251.1.54394 WP_000628251.1.54875 WP_000628251.1.55273 WP_000628251.1.55550 WP_000628251.1.56650 WP_000628251.1.57854 WP_000628251.1.58009 WP_000628251.1.58107 WP_000628251.1.58424 WP_000628251.1.58459 WP_000628251.1.58657 WP_000628251.1.5927 WP_000628251.1.59291 WP_000628251.1.59613 WP_000628251.1.59714 WP_000628251.1.59894 WP_000628251.1.59981 WP_000628251.1.60591 WP_000628251.1.613 WP_000628251.1.61442 WP_000628251.1.62038 WP_000628251.1.62236 WP_000628251.1.6282 WP_000628251.1.62951 WP_000628251.1.63814 WP_000628251.1.64312 WP_000628251.1.64875 WP_000628251.1.65355 WP_000628251.1.65405 WP_000628251.1.66071 WP_000628251.1.66255 WP_000628251.1.66668 WP_000628251.1.66984 WP_000628251.1.67055 WP_000628251.1.67284 WP_000628251.1.67894 WP_000628251.1.68058 WP_000628251.1.68231 WP_000628251.1.6859 WP_000628251.1.68735 WP_000628251.1.68877 WP_000628251.1.68911 WP_000628251.1.69327 WP_000628251.1.69502 WP_000628251.1.70300 WP_000628251.1.70386 WP_000628251.1.70408 WP_000628251.1.70655 WP_000628251.1.71562 WP_000628251.1.71607 WP_000628251.1.71972 WP_000628251.1.72048 WP_000628251.1.72588 WP_000628251.1.72596 WP_000628251.1.7309 WP_000628251.1.7407 WP_000628251.1.744 WP_000628251.1.76057 WP_000628251.1.76194 WP_000628251.1.76335 WP_000628251.1.77081 WP_000628251.1.7747 WP_000628251.1.77511 WP_000628251.1.78187 WP_000628251.1.804 WP_000628251.1.80558 WP_000628251.1.81186 WP_000628251.1.81418 WP_000628251.1.82166 WP_000628251.1.82589 WP_000628251.1.83393 WP_000628251.1.83668 WP_000628251.1.83936 WP_000628251.1.84197 WP_000628251.1.84326 WP_000628251.1.86586 WP_000628251.1.8705 WP_000628251.1.87504 WP_000628251.1.87590 WP_000628251.1.88260 WP_000628251.1.88562 WP_000628251.1.89427 WP_000628251.1.89747 WP_000628251.1.9119 WP_000628251.1.91482 WP_000628251.1.91887 WP_000628251.1.92053 WP_000628251.1.92201 WP_000628251.1.92403 WP_000628251.1.92648 WP_000628251.1.93533 WP_000628251.1.93694 WP_000628251.1.9420 WP_000628251.1.94282 WP_000628251.1.94446 WP_000628251.1.94704 WP_000628251.1.95310 WP_000628251.1.95858 WP_000628251.1.96253 WP_000628251.1.96478 WP_000628251.1.96633 WP_000628251.1.96676 WP_000628251.1.97525 WP_000628251.1.97654 WP_000628251.1.97778 WP_000628251.1.98727 WP_000628251.1.98775 WP_000628251.1.99401 WP_000628251.1.9950 WP_000628251.1.99549 gi|386604593|ref|YP_006110893.1| gi|117623652|ref|YP_852565.1| gi|91210642|ref|YP_540628.1| gi|544575884|ref|YP_008571408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]