SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 406327.Mevan_0358 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  406327.Mevan_0358
Domain Number 1 Region: 74-115
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000366
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 406327.Mevan_0358
Sequence length 118
Comment (Methanococcus vannielii SB)
Sequence
MELGHVFILLGMGIIVLEVFLPGLNFPVAGVAVLIYGIFLLFAPEWALPSALIAGLLTAY
LMKRFVYKTGLDVKIGAEKLIGEHGEIVDDILENNFGHVTINGERWQAKSSKSIKKRV
Download sequence
Identical sequences A6UP45
gi|150399112|ref|YP_001322879.1| 406327.Mevan_0358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]