SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 406327.Mevan_0625 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  406327.Mevan_0625
Domain Number 1 Region: 1-176
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.12e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 406327.Mevan_0625
Sequence length 176
Comment (Methanococcus vannielii SB)
Sequence
MRKEIRFSGFGGQGIILAGVILGKAASIYGEKESVQTQSYGPEARGGASKSEVVISNEEI
DFPKVIQPDILISMSQPAFDKYGFDLKENAVVIIDKDLVTLPEGYEEKYDVYKVPFTEIA
NKDVGLSIVANIVMLGALVKITEVVSKEALEKSLLDSIPKGTEKKNILAFEKGYSY
Download sequence
Identical sequences A6UPV9
WP_011972434.1.66029 gi|150399376|ref|YP_001323143.1| 406327.Mevan_0625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]