SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 406327.Mevan_1326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  406327.Mevan_1326
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.23e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 406327.Mevan_1326
Sequence length 199
Comment (Methanococcus vannielii SB)
Sequence
MSFNVLICGVGGQGIVLASRLVAVTAMNEGYTVNTAETIGMSQREGSVVSHVRFGNEIKG
SLIPEGFVDVIVGFEPSEVLRNIKYLKKGGKIIMNSKGIFPVSKSNNYKPEKIIEYIIEN
FNGTICMDFTKFAEELGNSKSLNVIMLGALFYADFIPISFEKFLETVKNEIPEKYLSLNI
SAAKKGAEEISKFLEGKYE
Download sequence
Identical sequences A6URV1
WP_012066138.1.66029 406327.Mevan_1326 gi|150400068|ref|YP_001323835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]