SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 406425.Bcenmc03_0276 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  406425.Bcenmc03_0276
Domain Number 1 Region: 157-433
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.05e-77
Family D-glucarate dehydratase-like 0.00000000256
Further Details:      
 
Domain Number 2 Region: 9-155
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.21e-25
Family Enolase N-terminal domain-like 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 406425.Bcenmc03_0276
Sequence length 465
Comment (Burkholderia cenocepacia MC0 3)
Sequence
MSEPSRAGTPRVTRMQVIPVAGRDSMLLNLCGAHAPHFTRNLVILDDSSGHTGVGEVPGG
EGIRHALERMTDLVVGQSIGRYQATLNAVRAALSGAGAGAGRTIRHEVTSAGEAAVLRQP
HEINLRLDNVITAIEAALLDLLGQHLDVPVAALLGEGQQRDAVPMLAYLFYIGDRRRTDL
PYRDEAQARAPWFRLRNEAALTPAEIARQAEAAVERYGFADFKLKGGVMAGADEMEAIAA
IKTRFPDARATLDPNGAWSLDEAVALCRGQGHLLAYAEDPCGPEAGYSGREVMAEFRRST
GIPTATNMIATDWRQMDHAVRLQAVDIPLADPHFWTMQGSVRLAQLCRDWGLTWGSHSNN
HFDVSLAMFTHAAAAAPGTITAIDTHWIWQEGDARLTREPLAIVGGKVAVPERPGLGIEI
DMTQVEAAHALYNAVDGTARDDAVAMRYLVPGWTYDPKRPSLGRV
Download sequence
Identical sequences B1JTL6
406425.Bcenmc03_0276 WP_012327727.1.90614 gi|170731631|ref|YP_001763578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]