SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 406425.Bcenmc03_2125 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  406425.Bcenmc03_2125
Domain Number 1 Region: 139-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.41e-128
Family Enolase 0.00000000906
Further Details:      
 
Domain Number 2 Region: 4-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.5e-55
Family Enolase N-terminal domain-like 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 406425.Bcenmc03_2125
Sequence length 427
Comment (Burkholderia cenocepacia MC0 3)
Sequence
MSAIVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYN
GKGVLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAK
AAAEEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALR
CGAEVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLA
LDCAASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHESDWDGWKLLT
DRLGKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYT
AVISHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGK
SAFYNLR
Download sequence
Identical sequences A0A071MPH9 A0A095DX78 A0A0D0HN51 A0A103ASV0 A0A103K1I4 A0A104E6F8 A0A124RL37 A0A124T4Z1 A0A1B4DIU8 A0A1B4S7D4 A0A2A4C7Y4 A0A2A9KPV9 A0A2G1SKN2 A0K8N1 A2VX47 A2W926 B1JUY6 B4EDA1 Q1BHS0 V4ZXF0
216591.BCAL2179 331271.Bcen_5970 331272.Bcen2424_2107 406425.Bcenmc03_2125 gi|116690128|ref|YP_835751.1| gi|170733461|ref|YP_001765408.1| WP_006478406.1.10003 WP_006478406.1.100292 WP_006478406.1.10056 WP_006478406.1.100564 WP_006478406.1.100630 WP_006478406.1.100706 WP_006478406.1.100762 WP_006478406.1.100828 WP_006478406.1.100899 WP_006478406.1.100949 WP_006478406.1.101155 WP_006478406.1.101546 WP_006478406.1.101682 WP_006478406.1.101897 WP_006478406.1.101991 WP_006478406.1.10305 WP_006478406.1.1047 WP_006478406.1.10541 WP_006478406.1.10592 WP_006478406.1.10826 WP_006478406.1.10851 WP_006478406.1.11207 WP_006478406.1.11227 WP_006478406.1.11355 WP_006478406.1.114 WP_006478406.1.1166 WP_006478406.1.12248 WP_006478406.1.12347 WP_006478406.1.12746 WP_006478406.1.12975 WP_006478406.1.13079 WP_006478406.1.13081 WP_006478406.1.13244 WP_006478406.1.13260 WP_006478406.1.13523 WP_006478406.1.13555 WP_006478406.1.13636 WP_006478406.1.14088 WP_006478406.1.14130 WP_006478406.1.14141 WP_006478406.1.14492 WP_006478406.1.14844 WP_006478406.1.15233 WP_006478406.1.15457 WP_006478406.1.15547 WP_006478406.1.15562 WP_006478406.1.15815 WP_006478406.1.16020 WP_006478406.1.16097 WP_006478406.1.16354 WP_006478406.1.16401 WP_006478406.1.16716 WP_006478406.1.16980 WP_006478406.1.17126 WP_006478406.1.17322 WP_006478406.1.17409 WP_006478406.1.1748 WP_006478406.1.18053 WP_006478406.1.18435 WP_006478406.1.18533 WP_006478406.1.19219 WP_006478406.1.19408 WP_006478406.1.19541 WP_006478406.1.19574 WP_006478406.1.19766 WP_006478406.1.19923 WP_006478406.1.19997 WP_006478406.1.20731 WP_006478406.1.21037 WP_006478406.1.21535 WP_006478406.1.21645 WP_006478406.1.21852 WP_006478406.1.21996 WP_006478406.1.22015 WP_006478406.1.22175 WP_006478406.1.22218 WP_006478406.1.22273 WP_006478406.1.22782 WP_006478406.1.22838 WP_006478406.1.22945 WP_006478406.1.23160 WP_006478406.1.23510 WP_006478406.1.23797 WP_006478406.1.24035 WP_006478406.1.24434 WP_006478406.1.24442 WP_006478406.1.24732 WP_006478406.1.24796 WP_006478406.1.24868 WP_006478406.1.24953 WP_006478406.1.25034 WP_006478406.1.25261 WP_006478406.1.25444 WP_006478406.1.25851 WP_006478406.1.25912 WP_006478406.1.26198 WP_006478406.1.26251 WP_006478406.1.26287 WP_006478406.1.26540 WP_006478406.1.26628 WP_006478406.1.26852 WP_006478406.1.27049 WP_006478406.1.27177 WP_006478406.1.27194 WP_006478406.1.27266 WP_006478406.1.27304 WP_006478406.1.27395 WP_006478406.1.27473 WP_006478406.1.27889 WP_006478406.1.27910 WP_006478406.1.28330 WP_006478406.1.28506 WP_006478406.1.2889 WP_006478406.1.29022 WP_006478406.1.29304 WP_006478406.1.29408 WP_006478406.1.2962 WP_006478406.1.29972 WP_006478406.1.30042 WP_006478406.1.30366 WP_006478406.1.30460 WP_006478406.1.30465 WP_006478406.1.30522 WP_006478406.1.30820 WP_006478406.1.30954 WP_006478406.1.31040 WP_006478406.1.31157 WP_006478406.1.31271 WP_006478406.1.31547 WP_006478406.1.32151 WP_006478406.1.32251 WP_006478406.1.32266 WP_006478406.1.32268 WP_006478406.1.32396 WP_006478406.1.32398 WP_006478406.1.3256 WP_006478406.1.326 WP_006478406.1.32964 WP_006478406.1.33137 WP_006478406.1.33293 WP_006478406.1.33877 WP_006478406.1.33927 WP_006478406.1.34318 WP_006478406.1.34366 WP_006478406.1.34524 WP_006478406.1.34550 WP_006478406.1.34593 WP_006478406.1.34628 WP_006478406.1.34650 WP_006478406.1.34976 WP_006478406.1.3508 WP_006478406.1.35154 WP_006478406.1.35207 WP_006478406.1.35280 WP_006478406.1.35329 WP_006478406.1.35688 WP_006478406.1.36134 WP_006478406.1.36137 WP_006478406.1.36301 WP_006478406.1.36423 WP_006478406.1.36557 WP_006478406.1.36634 WP_006478406.1.37059 WP_006478406.1.37217 WP_006478406.1.37287 WP_006478406.1.37542 WP_006478406.1.37961 WP_006478406.1.38439 WP_006478406.1.38451 WP_006478406.1.38687 WP_006478406.1.38713 WP_006478406.1.38736 WP_006478406.1.3886 WP_006478406.1.38916 WP_006478406.1.38944 WP_006478406.1.39067 WP_006478406.1.39114 WP_006478406.1.39276 WP_006478406.1.39563 WP_006478406.1.39955 WP_006478406.1.40056 WP_006478406.1.40221 WP_006478406.1.40288 WP_006478406.1.40453 WP_006478406.1.40482 WP_006478406.1.4090 WP_006478406.1.41261 WP_006478406.1.4130 WP_006478406.1.41480 WP_006478406.1.41560 WP_006478406.1.41971 WP_006478406.1.42312 WP_006478406.1.42426 WP_006478406.1.43021 WP_006478406.1.43054 WP_006478406.1.43226 WP_006478406.1.43317 WP_006478406.1.43417 WP_006478406.1.43430 WP_006478406.1.4378 WP_006478406.1.43880 WP_006478406.1.44082 WP_006478406.1.44508 WP_006478406.1.44577 WP_006478406.1.44630 WP_006478406.1.44701 WP_006478406.1.45178 WP_006478406.1.45285 WP_006478406.1.45618 WP_006478406.1.45869 WP_006478406.1.46051 WP_006478406.1.46591 WP_006478406.1.46650 WP_006478406.1.46700 WP_006478406.1.46780 WP_006478406.1.46794 WP_006478406.1.46848 WP_006478406.1.46998 WP_006478406.1.47115 WP_006478406.1.4712 WP_006478406.1.47292 WP_006478406.1.47300 WP_006478406.1.4735 WP_006478406.1.47688 WP_006478406.1.48005 WP_006478406.1.48066 WP_006478406.1.48119 WP_006478406.1.48260 WP_006478406.1.48439 WP_006478406.1.48470 WP_006478406.1.48497 WP_006478406.1.48555 WP_006478406.1.48997 WP_006478406.1.49486 WP_006478406.1.49612 WP_006478406.1.49743 WP_006478406.1.4986 WP_006478406.1.49932 WP_006478406.1.50276 WP_006478406.1.50301 WP_006478406.1.50445 WP_006478406.1.50481 WP_006478406.1.50508 WP_006478406.1.50602 WP_006478406.1.50658 WP_006478406.1.50701 WP_006478406.1.50840 WP_006478406.1.50902 WP_006478406.1.5101 WP_006478406.1.51045 WP_006478406.1.5123 WP_006478406.1.51256 WP_006478406.1.51264 WP_006478406.1.51375 WP_006478406.1.51404 WP_006478406.1.51583 WP_006478406.1.51790 WP_006478406.1.51974 WP_006478406.1.52033 WP_006478406.1.52293 WP_006478406.1.52424 WP_006478406.1.52578 WP_006478406.1.52651 WP_006478406.1.52657 WP_006478406.1.52705 WP_006478406.1.5376 WP_006478406.1.54239 WP_006478406.1.54258 WP_006478406.1.54490 WP_006478406.1.54803 WP_006478406.1.54850 WP_006478406.1.55042 WP_006478406.1.5508 WP_006478406.1.55282 WP_006478406.1.55547 WP_006478406.1.55843 WP_006478406.1.56058 WP_006478406.1.56735 WP_006478406.1.57358 WP_006478406.1.57447 WP_006478406.1.57568 WP_006478406.1.5773 WP_006478406.1.5825 WP_006478406.1.58490 WP_006478406.1.58556 WP_006478406.1.5864 WP_006478406.1.58874 WP_006478406.1.59134 WP_006478406.1.59186 WP_006478406.1.59191 WP_006478406.1.59223 WP_006478406.1.5924 WP_006478406.1.59344 WP_006478406.1.59406 WP_006478406.1.59452 WP_006478406.1.59475 WP_006478406.1.60115 WP_006478406.1.60193 WP_006478406.1.60310 WP_006478406.1.60412 WP_006478406.1.60488 WP_006478406.1.60629 WP_006478406.1.60885 WP_006478406.1.61069 WP_006478406.1.62175 WP_006478406.1.62695 WP_006478406.1.62916 WP_006478406.1.62945 WP_006478406.1.63022 WP_006478406.1.63048 WP_006478406.1.63204 WP_006478406.1.63423 WP_006478406.1.63472 WP_006478406.1.63558 WP_006478406.1.63701 WP_006478406.1.6376 WP_006478406.1.63776 WP_006478406.1.63898 WP_006478406.1.64016 WP_006478406.1.64260 WP_006478406.1.64261 WP_006478406.1.64495 WP_006478406.1.64618 WP_006478406.1.64825 WP_006478406.1.64842 WP_006478406.1.64887 WP_006478406.1.64958 WP_006478406.1.65050 WP_006478406.1.65187 WP_006478406.1.65532 WP_006478406.1.6566 WP_006478406.1.65805 WP_006478406.1.65850 WP_006478406.1.66286 WP_006478406.1.66306 WP_006478406.1.66661 WP_006478406.1.66737 WP_006478406.1.66837 WP_006478406.1.67103 WP_006478406.1.67255 WP_006478406.1.67275 WP_006478406.1.67345 WP_006478406.1.67372 WP_006478406.1.676 WP_006478406.1.67642 WP_006478406.1.67769 WP_006478406.1.6794 WP_006478406.1.68100 WP_006478406.1.68277 WP_006478406.1.68344 WP_006478406.1.68438 WP_006478406.1.69013 WP_006478406.1.69134 WP_006478406.1.69200 WP_006478406.1.69601 WP_006478406.1.69772 WP_006478406.1.7038 WP_006478406.1.70511 WP_006478406.1.70514 WP_006478406.1.70556 WP_006478406.1.70607 WP_006478406.1.70780 WP_006478406.1.70783 WP_006478406.1.7100 WP_006478406.1.71091 WP_006478406.1.71103 WP_006478406.1.71282 WP_006478406.1.71334 WP_006478406.1.7155 WP_006478406.1.71578 WP_006478406.1.71608 WP_006478406.1.71688 WP_006478406.1.72171 WP_006478406.1.72200 WP_006478406.1.72336 WP_006478406.1.72579 WP_006478406.1.72624 WP_006478406.1.72675 WP_006478406.1.7270 WP_006478406.1.73109 WP_006478406.1.73115 WP_006478406.1.7344 WP_006478406.1.73668 WP_006478406.1.74200 WP_006478406.1.74789 WP_006478406.1.75267 WP_006478406.1.75308 WP_006478406.1.75651 WP_006478406.1.75714 WP_006478406.1.75887 WP_006478406.1.75917 WP_006478406.1.75954 WP_006478406.1.75990 WP_006478406.1.76181 WP_006478406.1.76356 WP_006478406.1.76886 WP_006478406.1.7724 WP_006478406.1.77613 WP_006478406.1.77719 WP_006478406.1.77749 WP_006478406.1.77836 WP_006478406.1.77919 WP_006478406.1.78085 WP_006478406.1.783 WP_006478406.1.78433 WP_006478406.1.78542 WP_006478406.1.78617 WP_006478406.1.78666 WP_006478406.1.78878 WP_006478406.1.79353 WP_006478406.1.79411 WP_006478406.1.79438 WP_006478406.1.79621 WP_006478406.1.79903 WP_006478406.1.79921 WP_006478406.1.79954 WP_006478406.1.80069 WP_006478406.1.80221 WP_006478406.1.8059 WP_006478406.1.80650 WP_006478406.1.80663 WP_006478406.1.80947 WP_006478406.1.80961 WP_006478406.1.8203 WP_006478406.1.82124 WP_006478406.1.82360 WP_006478406.1.82669 WP_006478406.1.82703 WP_006478406.1.83057 WP_006478406.1.83090 WP_006478406.1.83171 WP_006478406.1.83220 WP_006478406.1.83270 WP_006478406.1.83528 WP_006478406.1.83617 WP_006478406.1.83765 WP_006478406.1.83848 WP_006478406.1.84587 WP_006478406.1.84901 WP_006478406.1.85078 WP_006478406.1.85154 WP_006478406.1.85218 WP_006478406.1.85579 WP_006478406.1.85676 WP_006478406.1.85713 WP_006478406.1.85744 WP_006478406.1.85815 WP_006478406.1.85892 WP_006478406.1.85952 WP_006478406.1.85992 WP_006478406.1.86127 WP_006478406.1.8623 WP_006478406.1.86231 WP_006478406.1.8632 WP_006478406.1.86513 WP_006478406.1.86620 WP_006478406.1.86925 WP_006478406.1.87166 WP_006478406.1.87490 WP_006478406.1.87716 WP_006478406.1.87780 WP_006478406.1.87798 WP_006478406.1.87884 WP_006478406.1.88043 WP_006478406.1.88080 WP_006478406.1.88184 WP_006478406.1.88381 WP_006478406.1.8869 WP_006478406.1.88782 WP_006478406.1.88887 WP_006478406.1.88913 WP_006478406.1.88916 WP_006478406.1.89063 WP_006478406.1.89250 WP_006478406.1.89316 WP_006478406.1.89494 WP_006478406.1.8972 WP_006478406.1.89848 WP_006478406.1.8987 WP_006478406.1.89939 WP_006478406.1.89946 WP_006478406.1.9013 WP_006478406.1.90152 WP_006478406.1.9034 WP_006478406.1.90478 WP_006478406.1.90595 WP_006478406.1.90614 WP_006478406.1.90654 WP_006478406.1.90674 WP_006478406.1.90806 WP_006478406.1.90836 WP_006478406.1.90933 WP_006478406.1.91074 WP_006478406.1.91451 WP_006478406.1.91457 WP_006478406.1.91699 WP_006478406.1.91929 WP_006478406.1.92089 WP_006478406.1.92582 WP_006478406.1.92898 WP_006478406.1.93286 WP_006478406.1.93500 WP_006478406.1.93858 WP_006478406.1.94108 WP_006478406.1.9467 WP_006478406.1.94712 WP_006478406.1.94819 WP_006478406.1.95083 WP_006478406.1.95150 WP_006478406.1.95224 WP_006478406.1.95268 WP_006478406.1.95357 WP_006478406.1.9541 WP_006478406.1.95626 WP_006478406.1.95790 WP_006478406.1.95833 WP_006478406.1.96061 WP_006478406.1.96252 WP_006478406.1.96385 WP_006478406.1.96531 WP_006478406.1.96618 WP_006478406.1.9680 WP_006478406.1.96852 WP_006478406.1.9698 WP_006478406.1.96992 WP_006478406.1.97069 WP_006478406.1.97307 WP_006478406.1.97398 WP_006478406.1.97867 WP_006478406.1.98001 WP_006478406.1.9804 WP_006478406.1.98056 WP_006478406.1.98120 WP_006478406.1.98227 WP_006478406.1.98478 WP_006478406.1.98528 WP_006478406.1.9876 WP_006478406.1.98819 WP_006478406.1.98955 WP_006478406.1.99008 WP_006478406.1.99257 WP_006478406.1.99341 WP_006478406.1.99398 WP_006478406.1.99658 WP_006478406.1.99710 WP_006478406.1.99750 WP_006478406.1.99910 WP_006478406.1.99967 WP_006478406.1.99975 WP_006478406.1.9998 gi|206560541|ref|YP_002231306.1| gi|107028713|ref|YP_625808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]