SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 406425.Bcenmc03_2500 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  406425.Bcenmc03_2500
Domain Number 1 Region: 123-384
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.8e-56
Family D-glucarate dehydratase-like 0.0000000166
Further Details:      
 
Domain Number 2 Region: 1-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.14e-30
Family Enolase N-terminal domain-like 0.000000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 406425.Bcenmc03_2500
Sequence length 388
Comment (Burkholderia cenocepacia MC0 3)
Sequence
MKIVEIREKTVPISSPIRNAYIDFSKMTLSLVAVITDVIRDGKPVIGYGFNSNGRYGQGK
LMRERFIPRILEADPASLIDDAGENLDPHKIWATMFTNEKPGGHGERSVAIGTIDMAIWD
AVAKIEGKPLFQLLADRYGNGQPDRKIFVYAAGGYYYPGQDHEKLKDEMRSYIDRGYTVV
KKKIGGASLDEDLRRIDSILSVLQDGQKLAVDANGRFDLDTAIQYAKALSQYDLFWYEEP
GDPLDFELQSTLRNYYDKPMATGEDLFSMQDARNLIRYGGMRPDRDWLQFDCALSYGLVE
YLRTLDMLRQHGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVKVEN
GYISMPDLPGIGFEGKSDLIAEMRKLSA
Download sequence
Identical sequences B1JWY1
gi|170733836|ref|YP_001765783.1| 406425.Bcenmc03_2500 WP_012329050.1.90614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]