SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 406425.Bcenmc03_5321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  406425.Bcenmc03_5321
Domain Number 1 Region: 56-161,192-250
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.47e-25
Family Clp protease, ClpP subunit 0.072
Further Details:      
 
Domain Number 2 Region: 456-501
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000235
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 406425.Bcenmc03_5321
Sequence length 516
Comment (Burkholderia cenocepacia MC0 3)
Sequence
MRFHRHGPPPAPAAPDGRPRHPLSARVARAALFAALLVVCAAVAAPPAADAPAAHPVVVI
PVNGAIGPASADFIVRSLDRAAREHAPLAILQLDTPGGLDTSMRQIIKAILGSPVPVAAF
VAPGGARAASAGTYIVYASHVAAMAPGTNLGAASPVQFGIGGGAPPGANPGAPRPTGASG
ASGVSDAATMLLTDTQSTEIRKAMQDASAYIRGLAQLRGRNAEWAERAVREAVSLSANEA
RAQHVVDLIAQDPADLARQLDGRAVTTTAGTLHLATAHAPLVVLAPDWRSRFLAIIADPN
VALILLTIGIYGLFFEFANPGFVLPGVAGTICLLVGLFAMQLLPVSYAGLGLVLLGLGCL
VAEAFLPTFGVLGFGGIVAFTIGALMLIDTDVPGYGIPWPVIASLALGGALLVAGVSSVA
LRARQRPVVTGAEAMLGSIGEVLDNGLQPDQPPGAAGAPSSAAGWARVHGERWRVASSAP
LAAGCRVRVTGRHGLTLTVAPLYDVPAPAHPQGEPS
Download sequence
Identical sequences B1K7S8
WP_012339621.1.90614 406425.Bcenmc03_5321 gi|170737678|ref|YP_001778938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]