SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 406425.Bcenmc03_6183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  406425.Bcenmc03_6183
Domain Number 1 Region: 250-299
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000836
Family AraC type transcriptional activator 0.018
Further Details:      
 
Domain Number 2 Region: 197-248
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000456
Family Tetracyclin repressor-like, N-terminal domain 0.052
Further Details:      
 
Weak hits

Sequence:  406425.Bcenmc03_6183
Domain Number - Region: 24-70
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00319
Family Gentisate 1,2-dioxygenase-like 0.055
Further Details:      
 
Domain Number - Region: 96-178
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.0876
Family Regulatory protein AraC 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 406425.Bcenmc03_6183
Sequence length 306
Comment (Burkholderia cenocepacia MC0 3)
Sequence
MDPLSEVLSLLETRDSFFTGLRAGGPWAVDLPPPDGIKFNAVVEGSCWLTVDGAGPPVRL
RTGDCFLLAAPRAFSLASDPSVAPVPAADVYRHLERGIAHYGEPADCFLIGGRFAYEEHM
PLLLGSLPPVVIVSGDSEPAAVLRWSLQQLAREFGASSPGGALMVRHLGHMMLVQILRRY
VDAGANGDVGWLAGFADARVSAALAAIHAAPERRWTVDALAACCHVSRSTFALHFKRRLG
FGPLEYVLRWRIQLAMRELRRSNASISAIAQRLGYDSDSAFGHAFKRIVGCSPRAYRHDA
TKEPGN
Download sequence
Identical sequences B1KAQ6
WP_012336722.1.90614 gi|170734684|ref|YP_001773798.1| 406425.Bcenmc03_6183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]