SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 407148.C8J_1381 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  407148.C8J_1381
Domain Number 1 Region: 794-1182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.04e-123
Family PFOR PP module 0.00000000813
Further Details:      
 
Domain Number 2 Region: 416-662
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-79
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000017
Further Details:      
 
Domain Number 3 Region: 5-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.24e-75
Family PFOR Pyr module 0.0000000244
Further Details:      
 
Domain Number 4 Region: 259-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.51e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.000016
Further Details:      
 
Domain Number 5 Region: 671-837
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.51e-18
Family Ferredoxin domains from multidomain proteins 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 407148.C8J_1381
Sequence length 1186
Comment (Campylobacter jejuni 81116)
Sequence
MGKIMKTMDGNEAAAYAAYAFTEVAGIYPITPSSPMADYTDMWAAAGKKNLFGVPVKIVE
MQSEAGAAGSVHGSLQAGALTTTYTASQGLLLKIPNMYKIAGQLLPCVIHVAARSLAAQA
LSIFGDHQDIYAARQIGFAMLCSHSVQETMDLAGVAHLAAIKGRVPFLHFFDGFRTSHEI
QKVEVMDYAHFDRLLDREALLEFRNNALNPENPKTRGTAQNDDIYFQTREVSNRFYDALP
DVVNEYMQEISKITGREYKPFTYYGHKEPERVIVAMGSVTQALEEVVDYLNAKGEKVGIL
KVYLYRPFSLKYFFDVMPKSVKKIAVLDRTKEPGSLGEPLYLDVKSAFYGRENAPVIVGG
RYGLSSKDVDPAQMIAVFENLKLDNPKDGFTVGIVDDVTHTSLSTGEKISLGDESTIECL
FYGLGADGTVGANKNSIKIIGDKTDFYAQAYFAYDSKKSGGYTRSHLRFSKKPIRSTYLV
STPHFIACSVAAYLEIYDVLAGIRKGGTFLLNSIWNAEETIRQLPDAVKKTLAEKEVNFY
IINATKLARDIGLGNRTNTIMQSAFFKLAKIIPYEDAQKYMKELAYKSYSKKGDAIVEMN
YKAIDVGADGLVKVEVDPNWKNLELKEKEQTNAYKGTEFVEKIVKPMNAAKGDDLPVSAF
LGYEDGSFEHGTTEYEKRGVGVMVPRWIEANCIQCNQCASVCPHAVIRPFLINDEEMANA
PRGVKDHALEAKGTKGEKLSFKIQVSPLDCTGCELCVHECPTKEKSLVMVPLQEEMDFGE
QENADYLFKEITYKDDILNKETTKGAQFAQPLFEFHGACPGCGETPYITLITRLFGERMI
VANATGCSSIYGGSAPSTPYRKSVKNGHGPAWGNSLFEDNAEFGLGMKIATENTRHRIEH
IMNESMQEVPNALSALFKDWIANKDNGAMSVEIKDKMIPILEQNKNIKAVQDILELKQYL
SKKSHWIFGGDGWAYDIGYGGLDHVLASGENVNILVLDTEVYSNTGGQSSKSSRTGAVAQ
FAAAGKPIQKKDLGQIAMTYGYIFVAQVNSTANYTHLIKAITAAEAYDGPSLVICYSPCI
AHGIKGGLGYSGEQGELATKCGYWPLYTFDPRLEEQGKNPLTLTGKEPDWDLYEQFLMNE
VRYNSLKKANPEHAAELFERNKKDAQRRYRQLKRIAMADYSNEVES
Download sequence
Identical sequences A0A0W8KZA9 A0A0W8LM11 A0A1J6U9V0
gi|384443843|ref|YP_005660095.1| gi|384442058|ref|YP_005658361.1| gi|157415700|ref|YP_001482956.1| gi|57238499|ref|YP_179630.1| 195099.CJE1649 407148.C8J_1381 WP_002877436.1.101351 WP_002877436.1.101503 WP_002877436.1.101723 WP_002877436.1.10733 WP_002877436.1.13308 WP_002877436.1.17476 WP_002877436.1.17574 WP_002877436.1.1908 WP_002877436.1.20368 WP_002877436.1.20424 WP_002877436.1.23184 WP_002877436.1.24786 WP_002877436.1.26622 WP_002877436.1.26811 WP_002877436.1.28212 WP_002877436.1.28815 WP_002877436.1.29911 WP_002877436.1.30396 WP_002877436.1.3182 WP_002877436.1.32115 WP_002877436.1.32595 WP_002877436.1.3307 WP_002877436.1.33150 WP_002877436.1.33281 WP_002877436.1.33800 WP_002877436.1.3467 WP_002877436.1.35424 WP_002877436.1.36238 WP_002877436.1.37001 WP_002877436.1.37441 WP_002877436.1.38579 WP_002877436.1.40824 WP_002877436.1.41676 WP_002877436.1.41786 WP_002877436.1.42130 WP_002877436.1.45712 WP_002877436.1.45744 WP_002877436.1.46471 WP_002877436.1.4756 WP_002877436.1.48191 WP_002877436.1.48196 WP_002877436.1.4932 WP_002877436.1.50766 WP_002877436.1.51298 WP_002877436.1.52362 WP_002877436.1.5263 WP_002877436.1.5371 WP_002877436.1.5402 WP_002877436.1.54432 WP_002877436.1.55453 WP_002877436.1.55555 WP_002877436.1.56766 WP_002877436.1.57393 WP_002877436.1.5784 WP_002877436.1.58047 WP_002877436.1.58472 WP_002877436.1.60705 WP_002877436.1.617 WP_002877436.1.62327 WP_002877436.1.64482 WP_002877436.1.65548 WP_002877436.1.67431 WP_002877436.1.68262 WP_002877436.1.69225 WP_002877436.1.70235 WP_002877436.1.71377 WP_002877436.1.71470 WP_002877436.1.71710 WP_002877436.1.74254 WP_002877436.1.74339 WP_002877436.1.77538 WP_002877436.1.77662 WP_002877436.1.79296 WP_002877436.1.80788 WP_002877436.1.81128 WP_002877436.1.81520 WP_002877436.1.81793 WP_002877436.1.8205 WP_002877436.1.82138 WP_002877436.1.84307 WP_002877436.1.84677 WP_002877436.1.84795 WP_002877436.1.85042 WP_002877436.1.8525 WP_002877436.1.85473 WP_002877436.1.8669 WP_002877436.1.87514 WP_002877436.1.9226 WP_002877436.1.92725 WP_002877436.1.93617 WP_002877436.1.93864 WP_002877436.1.9546 WP_002877436.1.95796 WP_002877436.1.96328 WP_002877436.1.97689 WP_002877436.1.98870 WP_002877436.1.99960 gi|549693433|ref|YP_008624391.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]