SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 407148.C8J_1573 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  407148.C8J_1573
Domain Number 1 Region: 138-405
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.63e-113
Family Enolase 0.000000167
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.16e-53
Family Enolase N-terminal domain-like 0.00000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 407148.C8J_1573
Sequence length 414
Comment (Campylobacter jejuni 81116)
Sequence
MLVIEDVRAYEVLDSRGNPTVKAEVTLSDGSVGAAIVPSGASTGSKEALELRDNDERFGG
KGVLKAVANVNETIADEILGLDAFNQTQLDDTLRELDGTNNYSNLGANATLGVSMATARA
AAAALGMPLYRYLGGANASILPVPMCNIINGGAHANNNVDFQEFMIMPFGFTSFKEALRS
VCEIYAILKKELANSGHSTALGDEGGFAPNLANNTEPIDLLMTCIKKAGYENRVKIALDV
ASTEFFKDGKYHMEGKAFSSEDLIERYVELCAKYPICSIEDGLAENDFEGWIKLTEKLGN
KIQLVGDDLFVTNEDILREGIIKKMANAVLIKPNQIGTITQTMRTVRLAQRNNYKCVMSH
RSGESEDAFIADFAVALNTGQIKTGALARGERTAKYNRLLEIELESDEYLGEKL
Download sequence
Identical sequences A0A1L7J3J3 A0A2J0YQN6 A1W1S4 A5KEY4 A8FNY3
gi|121612983|ref|YP_001001315.1| gi|157415891|ref|YP_001483147.1| gi|407943006|ref|YP_006858653.1| gi|549693626|ref|YP_008624584.1| gi|315125066|ref|YP_004067070.1| gi|384442245|ref|YP_005658548.1| WP_002856489.1.100027 WP_002856489.1.100331 WP_002856489.1.100542 WP_002856489.1.100676 WP_002856489.1.100887 WP_002856489.1.100890 WP_002856489.1.101120 WP_002856489.1.101242 WP_002856489.1.101299 WP_002856489.1.101503 WP_002856489.1.1018 WP_002856489.1.101807 WP_002856489.1.101886 WP_002856489.1.10286 WP_002856489.1.10588 WP_002856489.1.10601 WP_002856489.1.10699 WP_002856489.1.10733 WP_002856489.1.11028 WP_002856489.1.11065 WP_002856489.1.11659 WP_002856489.1.12514 WP_002856489.1.1272 WP_002856489.1.12799 WP_002856489.1.13240 WP_002856489.1.13308 WP_002856489.1.13562 WP_002856489.1.13569 WP_002856489.1.13698 WP_002856489.1.1376 WP_002856489.1.14014 WP_002856489.1.1410 WP_002856489.1.1433 WP_002856489.1.14405 WP_002856489.1.14781 WP_002856489.1.15561 WP_002856489.1.15640 WP_002856489.1.16428 WP_002856489.1.1679 WP_002856489.1.17262 WP_002856489.1.17476 WP_002856489.1.17486 WP_002856489.1.17574 WP_002856489.1.1773 WP_002856489.1.17906 WP_002856489.1.18181 WP_002856489.1.18202 WP_002856489.1.18427 WP_002856489.1.18713 WP_002856489.1.18954 WP_002856489.1.19018 WP_002856489.1.1908 WP_002856489.1.19202 WP_002856489.1.19299 WP_002856489.1.19580 WP_002856489.1.19695 WP_002856489.1.19870 WP_002856489.1.20077 WP_002856489.1.20237 WP_002856489.1.20285 WP_002856489.1.20368 WP_002856489.1.20424 WP_002856489.1.20589 WP_002856489.1.20956 WP_002856489.1.21419 WP_002856489.1.21976 WP_002856489.1.22150 WP_002856489.1.22220 WP_002856489.1.22410 WP_002856489.1.2270 WP_002856489.1.22767 WP_002856489.1.23128 WP_002856489.1.23143 WP_002856489.1.23184 WP_002856489.1.2411 WP_002856489.1.24720 WP_002856489.1.24786 WP_002856489.1.26 WP_002856489.1.26207 WP_002856489.1.26214 WP_002856489.1.26244 WP_002856489.1.26622 WP_002856489.1.26739 WP_002856489.1.27041 WP_002856489.1.27222 WP_002856489.1.27276 WP_002856489.1.27433 WP_002856489.1.27444 WP_002856489.1.27672 WP_002856489.1.28061 WP_002856489.1.28120 WP_002856489.1.28212 WP_002856489.1.28365 WP_002856489.1.2850 WP_002856489.1.28815 WP_002856489.1.29291 WP_002856489.1.29330 WP_002856489.1.29414 WP_002856489.1.29773 WP_002856489.1.29911 WP_002856489.1.30067 WP_002856489.1.30116 WP_002856489.1.30212 WP_002856489.1.30396 WP_002856489.1.3060 WP_002856489.1.3062 WP_002856489.1.30944 WP_002856489.1.31398 WP_002856489.1.32115 WP_002856489.1.32154 WP_002856489.1.32302 WP_002856489.1.32316 WP_002856489.1.32595 WP_002856489.1.32806 WP_002856489.1.32853 WP_002856489.1.3307 WP_002856489.1.33162 WP_002856489.1.33225 WP_002856489.1.33281 WP_002856489.1.33739 WP_002856489.1.33800 WP_002856489.1.34057 WP_002856489.1.34488 WP_002856489.1.34607 WP_002856489.1.3467 WP_002856489.1.3501 WP_002856489.1.35260 WP_002856489.1.35424 WP_002856489.1.35631 WP_002856489.1.36407 WP_002856489.1.36649 WP_002856489.1.37001 WP_002856489.1.37082 WP_002856489.1.37441 WP_002856489.1.37469 WP_002856489.1.37489 WP_002856489.1.3757 WP_002856489.1.38579 WP_002856489.1.38714 WP_002856489.1.3944 WP_002856489.1.39750 WP_002856489.1.39894 WP_002856489.1.39951 WP_002856489.1.40824 WP_002856489.1.41150 WP_002856489.1.41270 WP_002856489.1.41745 WP_002856489.1.41786 WP_002856489.1.42130 WP_002856489.1.42301 WP_002856489.1.42543 WP_002856489.1.42871 WP_002856489.1.43183 WP_002856489.1.43574 WP_002856489.1.43856 WP_002856489.1.44221 WP_002856489.1.44249 WP_002856489.1.44675 WP_002856489.1.44863 WP_002856489.1.45151 WP_002856489.1.45383 WP_002856489.1.45744 WP_002856489.1.46068 WP_002856489.1.46356 WP_002856489.1.46471 WP_002856489.1.468 WP_002856489.1.46805 WP_002856489.1.46943 WP_002856489.1.4756 WP_002856489.1.47718 WP_002856489.1.48191 WP_002856489.1.48196 WP_002856489.1.48271 WP_002856489.1.485 WP_002856489.1.48552 WP_002856489.1.49088 WP_002856489.1.4932 WP_002856489.1.50297 WP_002856489.1.50310 WP_002856489.1.50505 WP_002856489.1.50614 WP_002856489.1.50763 WP_002856489.1.50766 WP_002856489.1.5097 WP_002856489.1.5103 WP_002856489.1.51193 WP_002856489.1.51298 WP_002856489.1.52362 WP_002856489.1.5243 WP_002856489.1.52430 WP_002856489.1.52431 WP_002856489.1.5287 WP_002856489.1.53101 WP_002856489.1.5371 WP_002856489.1.53751 WP_002856489.1.53979 WP_002856489.1.5402 WP_002856489.1.54092 WP_002856489.1.54360 WP_002856489.1.54432 WP_002856489.1.54452 WP_002856489.1.54780 WP_002856489.1.55075 WP_002856489.1.55153 WP_002856489.1.55240 WP_002856489.1.55555 WP_002856489.1.55875 WP_002856489.1.56094 WP_002856489.1.56219 WP_002856489.1.56656 WP_002856489.1.56766 WP_002856489.1.56922 WP_002856489.1.5737 WP_002856489.1.57393 WP_002856489.1.57411 WP_002856489.1.57733 WP_002856489.1.5784 WP_002856489.1.58047 WP_002856489.1.58320 WP_002856489.1.58472 WP_002856489.1.58505 WP_002856489.1.58576 WP_002856489.1.59093 WP_002856489.1.59272 WP_002856489.1.59795 WP_002856489.1.59911 WP_002856489.1.60034 WP_002856489.1.60397 WP_002856489.1.6051 WP_002856489.1.60531 WP_002856489.1.60548 WP_002856489.1.60607 WP_002856489.1.61246 WP_002856489.1.617 WP_002856489.1.6187 WP_002856489.1.62153 WP_002856489.1.62305 WP_002856489.1.62439 WP_002856489.1.62672 WP_002856489.1.6284 WP_002856489.1.62922 WP_002856489.1.62948 WP_002856489.1.63837 WP_002856489.1.64025 WP_002856489.1.64056 WP_002856489.1.6406 WP_002856489.1.64482 WP_002856489.1.64790 WP_002856489.1.65073 WP_002856489.1.65190 WP_002856489.1.65500 WP_002856489.1.65548 WP_002856489.1.67431 WP_002856489.1.67675 WP_002856489.1.67955 WP_002856489.1.68262 WP_002856489.1.68599 WP_002856489.1.68625 WP_002856489.1.69031 WP_002856489.1.69225 WP_002856489.1.69275 WP_002856489.1.69516 WP_002856489.1.6976 WP_002856489.1.70203 WP_002856489.1.71377 WP_002856489.1.71465 WP_002856489.1.71470 WP_002856489.1.71710 WP_002856489.1.71884 WP_002856489.1.72197 WP_002856489.1.72239 WP_002856489.1.72780 WP_002856489.1.73097 WP_002856489.1.73383 WP_002856489.1.73534 WP_002856489.1.73724 WP_002856489.1.73810 WP_002856489.1.73916 WP_002856489.1.73951 WP_002856489.1.73972 WP_002856489.1.74254 WP_002856489.1.74315 WP_002856489.1.74339 WP_002856489.1.74360 WP_002856489.1.75705 WP_002856489.1.76146 WP_002856489.1.76444 WP_002856489.1.76546 WP_002856489.1.76559 WP_002856489.1.76834 WP_002856489.1.76904 WP_002856489.1.76967 WP_002856489.1.77454 WP_002856489.1.77538 WP_002856489.1.77573 WP_002856489.1.78165 WP_002856489.1.78209 WP_002856489.1.78370 WP_002856489.1.79296 WP_002856489.1.79396 WP_002856489.1.79682 WP_002856489.1.79833 WP_002856489.1.79937 WP_002856489.1.80006 WP_002856489.1.80017 WP_002856489.1.80289 WP_002856489.1.80425 WP_002856489.1.80694 WP_002856489.1.80788 WP_002856489.1.80802 WP_002856489.1.80825 WP_002856489.1.8102 WP_002856489.1.81128 WP_002856489.1.81435 WP_002856489.1.81520 WP_002856489.1.8175 WP_002856489.1.81793 WP_002856489.1.8205 WP_002856489.1.82138 WP_002856489.1.82311 WP_002856489.1.83266 WP_002856489.1.83436 WP_002856489.1.83522 WP_002856489.1.83548 WP_002856489.1.84261 WP_002856489.1.84307 WP_002856489.1.84677 WP_002856489.1.84835 WP_002856489.1.85042 WP_002856489.1.85240 WP_002856489.1.8525 WP_002856489.1.85473 WP_002856489.1.85911 WP_002856489.1.86318 WP_002856489.1.86555 WP_002856489.1.86557 WP_002856489.1.86579 WP_002856489.1.8669 WP_002856489.1.86929 WP_002856489.1.87295 WP_002856489.1.87478 WP_002856489.1.87495 WP_002856489.1.87527 WP_002856489.1.87669 WP_002856489.1.88134 WP_002856489.1.88713 WP_002856489.1.8880 WP_002856489.1.88975 WP_002856489.1.89236 WP_002856489.1.89296 WP_002856489.1.9044 WP_002856489.1.90766 WP_002856489.1.91378 WP_002856489.1.91489 WP_002856489.1.91537 WP_002856489.1.91661 WP_002856489.1.9194 WP_002856489.1.9196 WP_002856489.1.92170 WP_002856489.1.9226 WP_002856489.1.92325 WP_002856489.1.92680 WP_002856489.1.92725 WP_002856489.1.92761 WP_002856489.1.93020 WP_002856489.1.93057 WP_002856489.1.93617 WP_002856489.1.93864 WP_002856489.1.94405 WP_002856489.1.94563 WP_002856489.1.94694 WP_002856489.1.94702 WP_002856489.1.94840 WP_002856489.1.95060 WP_002856489.1.95087 WP_002856489.1.95360 WP_002856489.1.95411 WP_002856489.1.9546 WP_002856489.1.95496 WP_002856489.1.95796 WP_002856489.1.9582 WP_002856489.1.96328 WP_002856489.1.96363 WP_002856489.1.96501 WP_002856489.1.96510 WP_002856489.1.96691 WP_002856489.1.97120 WP_002856489.1.97790 WP_002856489.1.97809 WP_002856489.1.98210 WP_002856489.1.98367 WP_002856489.1.99021 WP_002856489.1.99612 WP_002856489.1.99717 WP_002856489.1.99812 WP_002856489.1.99893 WP_002856489.1.99960 354242.CJJ81176_1668 407148.C8J_1573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]