SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 407976.Sbal223_0177 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  407976.Sbal223_0177
Domain Number 1 Region: 151-330
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.76e-45
Family D-glucarate dehydratase-like 0.0000428
Further Details:      
 
Domain Number 2 Region: 5-123
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.000000000000265
Family Enolase N-terminal domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 407976.Sbal223_0177
Sequence length 366
Comment (Shewanella baltica OS223)
Sequence
MILTSLNLYQYRLPLDVLLPVGKQRIDHRAGLVLQACASANVGGEYRQVEVEIAPLSGID
IDEQVLVGFSRETLAQVQTALTELLPLLCGLHIDTLLDYAEQSPYPSLAFGLSLLHAKLM
GKLDAIRPQTATVPLIYHPTDAGKDLLDNKVAALGMHVHSVKVKVAQTSVEDELSLIYGI
LRTRPDLKLRLDANRGFTLEQAIEFAACLPLDTIEYIEEPCQNPQDNLAFYQAIGMPYAL
DESLNDPDYQFAMQNGLTALIIKPMLLGSIEKLANLIDTAQSYGVRCIISSSLESSLGIS
DLAHLAAILTPDEIPGLDTLSAFSQDLIVSSGKKHCLTLAQLELIAQHAIDSTQQSDLGA
AKREEN
Download sequence
Identical sequences B8E3U9
407976.Sbal223_0177 gi|217971386|ref|YP_002356137.1| WP_012586443.1.74325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]