SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 407976.Sbal223_0493 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  407976.Sbal223_0493
Domain Number - Region: 99-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00235
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 407976.Sbal223_0493
Sequence length 156
Comment (Shewanella baltica OS223)
Sequence
MEFSNPILVWAVVGLVFMLAEIVVPGGIIVLLGAACLVVAGALGIGLVEGVVQSMTLWFI
SAIVLLLTFRQVTQRLVGGDSHVDNTDEAIDLYNQIVRVKQTIGPGQAPGRVEFQGSEWP
ALGDGTTIAAGTEVRIICRENIALVVEPISIEASKN
Download sequence
Identical sequences B8E6G4
gi|217971699|ref|YP_002356450.1| WP_012586650.1.74325 407976.Sbal223_0493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]