SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 407976.Sbal223_1362 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  407976.Sbal223_1362
Domain Number - Region: 28-72
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0314
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 407976.Sbal223_1362
Sequence length 100
Comment (Shewanella baltica OS223)
Sequence
MMAKWVKLAAVATLALGMSSAWAQGVAHEGTVVDTMNGGGYTYVQIKEADTTFWAAGPQT
EVSKGDKVAVVEQMWMNEFTSKTLNRTFDKLLFVGQIDKK
Download sequence
Identical sequences B8E9R6
WP_012587178.1.74325 gi|217972542|ref|YP_002357293.1| 407976.Sbal223_1362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]