SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 409438.ECSE_0513 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  409438.ECSE_0513
Domain Number 1 Region: 95-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000942
Family NfeD domain-like 0.0079
Further Details:      
 
Weak hits

Sequence:  409438.ECSE_0513
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0017
Family Glycerol-3-phosphate transporter 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 409438.ECSE_0513
Sequence length 152
Comment (Escherichia coli SE11)
Sequence
MMELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVSAVITGLVVWLVPLGWEWQGVMF
AILTLLAAWLWWEWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS
WPVSASEDLGAGTHVEVIAIEGITLHIRAVSS
Download sequence
Identical sequences A0A2I6I564 B6I0D8
WP_000970334.1.101102 WP_000970334.1.15521 WP_000970334.1.15809 WP_000970334.1.15945 WP_000970334.1.16388 WP_000970334.1.16745 WP_000970334.1.17403 WP_000970334.1.17595 WP_000970334.1.19544 WP_000970334.1.20483 WP_000970334.1.24473 WP_000970334.1.24483 WP_000970334.1.26130 WP_000970334.1.26912 WP_000970334.1.30428 WP_000970334.1.32089 WP_000970334.1.35604 WP_000970334.1.36412 WP_000970334.1.37554 WP_000970334.1.37926 WP_000970334.1.39607 WP_000970334.1.40315 WP_000970334.1.40563 WP_000970334.1.45053 WP_000970334.1.4646 WP_000970334.1.4740 WP_000970334.1.49312 WP_000970334.1.51837 WP_000970334.1.53262 WP_000970334.1.54546 WP_000970334.1.54918 WP_000970334.1.5685 WP_000970334.1.57100 WP_000970334.1.57638 WP_000970334.1.59280 WP_000970334.1.59434 WP_000970334.1.6064 WP_000970334.1.61225 WP_000970334.1.61758 WP_000970334.1.63576 WP_000970334.1.65023 WP_000970334.1.66007 WP_000970334.1.68278 WP_000970334.1.68956 WP_000970334.1.71354 WP_000970334.1.7192 WP_000970334.1.72608 WP_000970334.1.72725 WP_000970334.1.72729 WP_000970334.1.73349 WP_000970334.1.74670 WP_000970334.1.74687 WP_000970334.1.75360 WP_000970334.1.77581 WP_000970334.1.78515 WP_000970334.1.79391 WP_000970334.1.80985 WP_000970334.1.81869 WP_000970334.1.81914 WP_000970334.1.83564 WP_000970334.1.87358 WP_000970334.1.87400 WP_000970334.1.89432 WP_000970334.1.8945 WP_000970334.1.9059 WP_000970334.1.91685 WP_000970334.1.93072 WP_000970334.1.93743 WP_000970334.1.93877 WP_000970334.1.93918 WP_000970334.1.95381 WP_000970334.1.95824 WP_000970334.1.96053 WP_000970334.1.96222 WP_000970334.1.97049 WP_000970334.1.97200 WP_000970334.1.98654 WP_000970334.1.99804 409438.ECSE_0513 gi|209917704|ref|YP_002291788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]