SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 409438.ECSE_1461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  409438.ECSE_1461
Domain Number 1 Region: 794-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.14e-118
Family PFOR PP module 0.0000000338
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.54e-77
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000122
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5e-71
Family PFOR Pyr module 0.000000108
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.86e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000197
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.7e-23
Family Ferredoxin domains from multidomain proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 409438.ECSE_1461
Sequence length 1174
Comment (Escherichia coli SE11)
Sequence
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAANVQEAQDFALISQIATLKSRVPFIHFFDGFRTSHEINKIV
PLADDTILDLMPQVEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYDAVYDHVE
QAMNDFSAATGRQYQPFEYYGHPQAERVIILMGSAIGTCEEVVDELLTRGEKVGVLKVRL
YRPFSAKHLLQALPGSVRSVAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRVI
GGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDDVTNLSLPLPENTLPNSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEQPIRSAYL
ISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVINAAKIARECGLAARINTVMQMAFFHLTQILPGDSALAELQGAIAKSYSSKGQDLVER
NWQALALARESVEEVPLQPVNPHSANRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNHCVAACPHSAIRAKVVPPEAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KINYDFFLNLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRVRVLRL
LDQFADKIPAELLTALKSDATPEVRREQVAALRQQLNDVAEAHELLRDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSEALEETLLHEQRFRRLNSQQP
EVAEQLWKDAAADLQKRYDFLAQMAGKAEKSNTD
Download sequence
Identical sequences A0A2I5I9Y9 B6IAC4 E9T8F0
409438.ECSE_1461 WP_000628232.1.100752 WP_000628232.1.101102 WP_000628232.1.10922 WP_000628232.1.11071 WP_000628232.1.11699 WP_000628232.1.12030 WP_000628232.1.1275 WP_000628232.1.12831 WP_000628232.1.12876 WP_000628232.1.13301 WP_000628232.1.13924 WP_000628232.1.14601 WP_000628232.1.15416 WP_000628232.1.15521 WP_000628232.1.15809 WP_000628232.1.15945 WP_000628232.1.16171 WP_000628232.1.163 WP_000628232.1.16388 WP_000628232.1.16745 WP_000628232.1.17297 WP_000628232.1.17403 WP_000628232.1.19544 WP_000628232.1.20251 WP_000628232.1.20325 WP_000628232.1.20483 WP_000628232.1.20785 WP_000628232.1.21441 WP_000628232.1.22138 WP_000628232.1.22631 WP_000628232.1.23026 WP_000628232.1.23035 WP_000628232.1.23915 WP_000628232.1.24068 WP_000628232.1.24374 WP_000628232.1.24473 WP_000628232.1.24483 WP_000628232.1.24946 WP_000628232.1.25631 WP_000628232.1.26130 WP_000628232.1.26264 WP_000628232.1.26325 WP_000628232.1.26658 WP_000628232.1.26912 WP_000628232.1.27741 WP_000628232.1.2826 WP_000628232.1.28950 WP_000628232.1.28953 WP_000628232.1.29176 WP_000628232.1.31740 WP_000628232.1.32089 WP_000628232.1.32232 WP_000628232.1.34794 WP_000628232.1.35006 WP_000628232.1.35604 WP_000628232.1.36071 WP_000628232.1.36412 WP_000628232.1.36500 WP_000628232.1.36826 WP_000628232.1.37252 WP_000628232.1.37554 WP_000628232.1.37634 WP_000628232.1.37926 WP_000628232.1.38694 WP_000628232.1.38896 WP_000628232.1.39607 WP_000628232.1.39822 WP_000628232.1.40315 WP_000628232.1.40617 WP_000628232.1.4082 WP_000628232.1.40865 WP_000628232.1.41315 WP_000628232.1.42367 WP_000628232.1.42522 WP_000628232.1.42661 WP_000628232.1.44292 WP_000628232.1.44587 WP_000628232.1.44608 WP_000628232.1.45053 WP_000628232.1.45301 WP_000628232.1.46070 WP_000628232.1.46477 WP_000628232.1.46614 WP_000628232.1.46882 WP_000628232.1.47477 WP_000628232.1.49312 WP_000628232.1.49987 WP_000628232.1.50353 WP_000628232.1.51837 WP_000628232.1.53155 WP_000628232.1.53238 WP_000628232.1.53262 WP_000628232.1.53809 WP_000628232.1.54169 WP_000628232.1.54546 WP_000628232.1.54798 WP_000628232.1.54918 WP_000628232.1.55381 WP_000628232.1.55552 WP_000628232.1.56513 WP_000628232.1.57100 WP_000628232.1.57738 WP_000628232.1.58045 WP_000628232.1.58622 WP_000628232.1.59434 WP_000628232.1.59737 WP_000628232.1.6064 WP_000628232.1.61225 WP_000628232.1.61758 WP_000628232.1.62264 WP_000628232.1.62818 WP_000628232.1.63576 WP_000628232.1.64193 WP_000628232.1.65023 WP_000628232.1.66007 WP_000628232.1.67841 WP_000628232.1.68956 WP_000628232.1.69551 WP_000628232.1.70694 WP_000628232.1.71354 WP_000628232.1.71540 WP_000628232.1.7192 WP_000628232.1.72643 WP_000628232.1.72725 WP_000628232.1.72729 WP_000628232.1.73349 WP_000628232.1.74423 WP_000628232.1.74670 WP_000628232.1.74687 WP_000628232.1.76965 WP_000628232.1.77437 WP_000628232.1.77581 WP_000628232.1.77929 WP_000628232.1.78515 WP_000628232.1.78854 WP_000628232.1.81182 WP_000628232.1.82240 WP_000628232.1.83564 WP_000628232.1.84172 WP_000628232.1.84313 WP_000628232.1.84850 WP_000628232.1.85112 WP_000628232.1.86307 WP_000628232.1.86833 WP_000628232.1.8687 WP_000628232.1.87109 WP_000628232.1.87358 WP_000628232.1.87400 WP_000628232.1.88462 WP_000628232.1.89432 WP_000628232.1.90266 WP_000628232.1.90332 WP_000628232.1.9059 WP_000628232.1.90979 WP_000628232.1.91685 WP_000628232.1.9266 WP_000628232.1.93072 WP_000628232.1.93252 WP_000628232.1.93509 WP_000628232.1.93743 WP_000628232.1.93873 WP_000628232.1.93877 WP_000628232.1.93918 WP_000628232.1.94889 WP_000628232.1.95005 WP_000628232.1.95381 WP_000628232.1.95824 WP_000628232.1.96053 WP_000628232.1.96222 WP_000628232.1.96494 WP_000628232.1.97049 WP_000628232.1.97200 WP_000628232.1.98654 WP_000628232.1.99345 WP_000628232.1.99804 WP_000628232.1.99827 gi|209918652|ref|YP_002292736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]