SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 410289.BCG_0995c from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410289.BCG_0995c
Domain Number 1 Region: 16-124
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000114
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 410289.BCG_0995c
Sequence length 257
Comment (Mycobacterium bovis BCG Pasteur 1173P2)
Sequence
MVAVSTAAKSPTALAIAVRTQDSVVILTADGALDSSSSALLRDSLTRATLEQPSAVIVNV
TELQVAEESAWSVFISARWQADFRADVPVLLVCGHRAGRAAVTRTGVARFMPVYPTEKAA
SKAIGRLARRNFKRSDAQLPANLNSLRESRQLVREWLTQWSRPGLIPVALVVVNVFVENV
LKHTGSDPVMRIESDGPTATIAVSDGSSAPAVRLASPPKGIDVSGLAIVAALSRAWGSSP
TSSGKTVWAIIGPENQL
Download sequence
Identical sequences A0A0H3MBM5 A0A1R3XWX7 A0A243QQV5 A0A2C5SL63 A5U0Y1 F8M4I6 L7N4F7 M8CQV5 P71568 R4M6L4
gi|339631003|ref|YP_004722645.1| gi|121636866|ref|YP_977089.1| gi|15840364|ref|NP_335401.1| gi|479313826|ref|YP_007853878.1| gi|433630043|ref|YP_007263671.1| gi|494695338|ref|YP_007960841.1| gi|378770700|ref|YP_005170433.1| gi|479054892|ref|YP_007350698.1| gi|224989337|ref|YP_002644024.1| gi|148660720|ref|YP_001282243.1| NP_215456.1.84033 WP_003404823.1.100000 WP_003404823.1.100021 WP_003404823.1.100069 WP_003404823.1.100087 WP_003404823.1.10015 WP_003404823.1.100208 WP_003404823.1.100216 WP_003404823.1.10022 WP_003404823.1.100255 WP_003404823.1.100260 WP_003404823.1.100270 WP_003404823.1.100279 WP_003404823.1.100286 WP_003404823.1.100308 WP_003404823.1.100309 WP_003404823.1.100318 WP_003404823.1.100337 WP_003404823.1.100338 WP_003404823.1.10037 WP_003404823.1.100383 WP_003404823.1.100395 WP_003404823.1.100396 WP_003404823.1.1004 WP_003404823.1.100401 WP_003404823.1.100460 WP_003404823.1.100552 WP_003404823.1.100581 WP_003404823.1.100600 WP_003404823.1.100625 WP_003404823.1.10064 WP_003404823.1.100666 WP_003404823.1.100671 WP_003404823.1.100677 WP_003404823.1.100697 WP_003404823.1.100703 WP_003404823.1.100716 WP_003404823.1.100722 WP_003404823.1.100754 WP_003404823.1.100757 WP_003404823.1.100772 WP_003404823.1.1008 WP_003404823.1.100812 WP_003404823.1.100866 WP_003404823.1.10088 WP_003404823.1.100889 WP_003404823.1.10090 WP_003404823.1.100910 WP_003404823.1.100915 WP_003404823.1.100918 WP_003404823.1.100935 WP_003404823.1.100984 WP_003404823.1.100992 WP_003404823.1.100998 WP_003404823.1.101 WP_003404823.1.101025 WP_003404823.1.101028 WP_003404823.1.10104 WP_003404823.1.101048 WP_003404823.1.101054 WP_003404823.1.101075 WP_003404823.1.101143 WP_003404823.1.101146 WP_003404823.1.10116 WP_003404823.1.10117 WP_003404823.1.101209 WP_003404823.1.10125 WP_003404823.1.101290 WP_003404823.1.101323 WP_003404823.1.101324 WP_003404823.1.101350 WP_003404823.1.101367 WP_003404823.1.101398 WP_003404823.1.101403 WP_003404823.1.101421 WP_003404823.1.10144 WP_003404823.1.101442 WP_003404823.1.10145 WP_003404823.1.101452 WP_003404823.1.101456 WP_003404823.1.101481 WP_003404823.1.101493 WP_003404823.1.101496 WP_003404823.1.101525 WP_003404823.1.101533 WP_003404823.1.101535 WP_003404823.1.101553 WP_003404823.1.101558 WP_003404823.1.10156 WP_003404823.1.101573 WP_003404823.1.10159 WP_003404823.1.101592 WP_003404823.1.101604 WP_003404823.1.101607 WP_003404823.1.101622 WP_003404823.1.101644 WP_003404823.1.101659 WP_003404823.1.101671 WP_003404823.1.101687 WP_003404823.1.101698 WP_003404823.1.10170 WP_003404823.1.101713 WP_003404823.1.101722 WP_003404823.1.101733 WP_003404823.1.101743 WP_003404823.1.101753 WP_003404823.1.101764 WP_003404823.1.101773 WP_003404823.1.101795 WP_003404823.1.101797 WP_003404823.1.101798 WP_003404823.1.101802 WP_003404823.1.101826 WP_003404823.1.101836 WP_003404823.1.101858 WP_003404823.1.101859 WP_003404823.1.101888 WP_003404823.1.101894 WP_003404823.1.101899 WP_003404823.1.1019 WP_003404823.1.101923 WP_003404823.1.101925 WP_003404823.1.10193 WP_003404823.1.101996 WP_003404823.1.102 WP_003404823.1.102008 WP_003404823.1.102017 WP_003404823.1.102053 WP_003404823.1.102055 WP_003404823.1.102063 WP_003404823.1.102099 WP_003404823.1.1021 WP_003404823.1.10211 WP_003404823.1.102119 WP_003404823.1.102121 WP_003404823.1.102143 WP_003404823.1.10216 WP_003404823.1.10224 WP_003404823.1.10253 WP_003404823.1.10262 WP_003404823.1.10272 WP_003404823.1.10277 WP_003404823.1.1033 WP_003404823.1.10350 WP_003404823.1.10362 WP_003404823.1.10366 WP_003404823.1.10376 WP_003404823.1.10396 WP_003404823.1.10410 WP_003404823.1.10414 WP_003404823.1.10421 WP_003404823.1.10430 WP_003404823.1.1044 WP_003404823.1.10440 WP_003404823.1.10445 WP_003404823.1.10471 WP_003404823.1.10472 WP_003404823.1.10489 WP_003404823.1.105 WP_003404823.1.10518 WP_003404823.1.10523 WP_003404823.1.10545 WP_003404823.1.1057 WP_003404823.1.10594 WP_003404823.1.10603 WP_003404823.1.10606 WP_003404823.1.10615 WP_003404823.1.10623 WP_003404823.1.10635 WP_003404823.1.10643 WP_003404823.1.10648 WP_003404823.1.10662 WP_003404823.1.10709 WP_003404823.1.10735 WP_003404823.1.10740 WP_003404823.1.10756 WP_003404823.1.1078 WP_003404823.1.10791 WP_003404823.1.10799 WP_003404823.1.10825 WP_003404823.1.10848 WP_003404823.1.10879 WP_003404823.1.10912 WP_003404823.1.10916 WP_003404823.1.10923 WP_003404823.1.10927 WP_003404823.1.1095 WP_003404823.1.10956 WP_003404823.1.10958 WP_003404823.1.10962 WP_003404823.1.10980 WP_003404823.1.10981 WP_003404823.1.10993 WP_003404823.1.1100 WP_003404823.1.11040 WP_003404823.1.11061 WP_003404823.1.11070 WP_003404823.1.11141 WP_003404823.1.11171 WP_003404823.1.11175 WP_003404823.1.11176 WP_003404823.1.11222 WP_003404823.1.11236 WP_003404823.1.11329 WP_003404823.1.1133 WP_003404823.1.11342 WP_003404823.1.11373 WP_003404823.1.11376 WP_003404823.1.11390 WP_003404823.1.11402 WP_003404823.1.11481 WP_003404823.1.11487 WP_003404823.1.11489 WP_003404823.1.11491 WP_003404823.1.11514 WP_003404823.1.11587 WP_003404823.1.11589 WP_003404823.1.11596 WP_003404823.1.11604 WP_003404823.1.11610 WP_003404823.1.11697 WP_003404823.1.11707 WP_003404823.1.11752 WP_003404823.1.11758 WP_003404823.1.11761 WP_003404823.1.11775 WP_003404823.1.11822 WP_003404823.1.11826 WP_003404823.1.11856 WP_003404823.1.11898 WP_003404823.1.11906 WP_003404823.1.11939 WP_003404823.1.11960 WP_003404823.1.11961 WP_003404823.1.11972 WP_003404823.1.11984 WP_003404823.1.120 WP_003404823.1.12001 WP_003404823.1.12049 WP_003404823.1.12052 WP_003404823.1.12100 WP_003404823.1.12116 WP_003404823.1.12130 WP_003404823.1.12133 WP_003404823.1.12161 WP_003404823.1.12165 WP_003404823.1.12184 WP_003404823.1.12187 WP_003404823.1.12190 WP_003404823.1.12216 WP_003404823.1.12265 WP_003404823.1.12275 WP_003404823.1.12293 WP_003404823.1.12294 WP_003404823.1.123 WP_003404823.1.1231 WP_003404823.1.12314 WP_003404823.1.12327 WP_003404823.1.12338 WP_003404823.1.1236 WP_003404823.1.12371 WP_003404823.1.12372 WP_003404823.1.12389 WP_003404823.1.12406 WP_003404823.1.1241 WP_003404823.1.12421 WP_003404823.1.12424 WP_003404823.1.12446 WP_003404823.1.12464 WP_003404823.1.12479 WP_003404823.1.12519 WP_003404823.1.12523 WP_003404823.1.12526 WP_003404823.1.1255 WP_003404823.1.12550 WP_003404823.1.12551 WP_003404823.1.12563 WP_003404823.1.12611 WP_003404823.1.12669 WP_003404823.1.1267 WP_003404823.1.12672 WP_003404823.1.12692 WP_003404823.1.1271 WP_003404823.1.12710 WP_003404823.1.12768 WP_003404823.1.1279 WP_003404823.1.12794 WP_003404823.1.12804 WP_003404823.1.12821 WP_003404823.1.12841 WP_003404823.1.12854 WP_003404823.1.12871 WP_003404823.1.12901 WP_003404823.1.12941 WP_003404823.1.12947 WP_003404823.1.12957 WP_003404823.1.12972 WP_003404823.1.13028 WP_003404823.1.13043 WP_003404823.1.13086 WP_003404823.1.13087 WP_003404823.1.13090 WP_003404823.1.13096 WP_003404823.1.13163 WP_003404823.1.13175 WP_003404823.1.13183 WP_003404823.1.132 WP_003404823.1.13249 WP_003404823.1.13284 WP_003404823.1.13296 WP_003404823.1.13298 WP_003404823.1.13302 WP_003404823.1.13306 WP_003404823.1.13312 WP_003404823.1.13313 WP_003404823.1.13321 WP_003404823.1.13345 WP_003404823.1.13358 WP_003404823.1.13370 WP_003404823.1.13375 WP_003404823.1.1338 WP_003404823.1.13420 WP_003404823.1.13433 WP_003404823.1.13435 WP_003404823.1.13438 WP_003404823.1.13461 WP_003404823.1.13466 WP_003404823.1.13489 WP_003404823.1.13526 WP_003404823.1.13551 WP_003404823.1.13564 WP_003404823.1.13579 WP_003404823.1.13647 WP_003404823.1.13667 WP_003404823.1.13687 WP_003404823.1.13697 WP_003404823.1.13719 WP_003404823.1.13763 WP_003404823.1.1377 WP_003404823.1.13774 WP_003404823.1.13786 WP_003404823.1.13793 WP_003404823.1.13794 WP_003404823.1.13817 WP_003404823.1.13834 WP_003404823.1.13866 WP_003404823.1.13880 WP_003404823.1.13899 WP_003404823.1.13909 WP_003404823.1.13910 WP_003404823.1.13919 WP_003404823.1.13920 WP_003404823.1.13952 WP_003404823.1.13953 WP_003404823.1.13962 WP_003404823.1.1398 WP_003404823.1.13988 WP_003404823.1.14027 WP_003404823.1.14046 WP_003404823.1.14115 WP_003404823.1.1415 WP_003404823.1.14152 WP_003404823.1.14158 WP_003404823.1.14162 WP_003404823.1.14175 WP_003404823.1.14178 WP_003404823.1.14194 WP_003404823.1.14195 WP_003404823.1.14208 WP_003404823.1.14238 WP_003404823.1.14266 WP_003404823.1.14273 WP_003404823.1.14303 WP_003404823.1.14306 WP_003404823.1.14307 WP_003404823.1.14310 WP_003404823.1.14341 WP_003404823.1.14382 WP_003404823.1.14416 WP_003404823.1.14428 WP_003404823.1.14441 WP_003404823.1.14469 WP_003404823.1.14477 WP_003404823.1.14504 WP_003404823.1.14514 WP_003404823.1.1452 WP_003404823.1.14527 WP_003404823.1.1454 WP_003404823.1.14544 WP_003404823.1.14548 WP_003404823.1.14551 WP_003404823.1.14561 WP_003404823.1.14573 WP_003404823.1.1462 WP_003404823.1.14658 WP_003404823.1.14667 WP_003404823.1.14668 WP_003404823.1.14675 WP_003404823.1.14694 WP_003404823.1.14695 WP_003404823.1.14709 WP_003404823.1.14766 WP_003404823.1.14783 WP_003404823.1.14865 WP_003404823.1.14872 WP_003404823.1.14905 WP_003404823.1.14926 WP_003404823.1.14951 WP_003404823.1.14955 WP_003404823.1.15003 WP_003404823.1.15009 WP_003404823.1.15028 WP_003404823.1.15040 WP_003404823.1.15052 WP_003404823.1.15065 WP_003404823.1.15072 WP_003404823.1.15089 WP_003404823.1.1509 WP_003404823.1.15126 WP_003404823.1.15131 WP_003404823.1.15168 WP_003404823.1.15172 WP_003404823.1.15174 WP_003404823.1.15187 WP_003404823.1.15196 WP_003404823.1.15210 WP_003404823.1.15216 WP_003404823.1.15217 WP_003404823.1.1523 WP_003404823.1.15232 WP_003404823.1.15238 WP_003404823.1.15240 WP_003404823.1.15253 WP_003404823.1.15267 WP_003404823.1.1527 WP_003404823.1.15292 WP_003404823.1.15299 WP_003404823.1.15302 WP_003404823.1.15322 WP_003404823.1.1534 WP_003404823.1.15345 WP_003404823.1.15365 WP_003404823.1.15372 WP_003404823.1.15386 WP_003404823.1.15387 WP_003404823.1.15442 WP_003404823.1.15447 WP_003404823.1.15449 WP_003404823.1.15477 WP_003404823.1.15481 WP_003404823.1.15492 WP_003404823.1.15511 WP_003404823.1.15512 WP_003404823.1.15558 WP_003404823.1.15559 WP_003404823.1.15566 WP_003404823.1.15599 WP_003404823.1.1560 WP_003404823.1.15611 WP_003404823.1.1563 WP_003404823.1.15633 WP_003404823.1.15643 WP_003404823.1.15688 WP_003404823.1.15755 WP_003404823.1.15763 WP_003404823.1.15774 WP_003404823.1.1578 WP_003404823.1.15780 WP_003404823.1.15827 WP_003404823.1.15834 WP_003404823.1.15842 WP_003404823.1.15853 WP_003404823.1.15870 WP_003404823.1.15877 WP_003404823.1.15893 WP_003404823.1.15896 WP_003404823.1.15926 WP_003404823.1.15933 WP_003404823.1.15946 WP_003404823.1.15958 WP_003404823.1.15973 WP_003404823.1.15987 WP_003404823.1.15993 WP_003404823.1.16009 WP_003404823.1.16025 WP_003404823.1.16043 WP_003404823.1.16055 WP_003404823.1.16066 WP_003404823.1.16069 WP_003404823.1.16077 WP_003404823.1.16106 WP_003404823.1.16108 WP_003404823.1.16110 WP_003404823.1.16130 WP_003404823.1.16136 WP_003404823.1.16139 WP_003404823.1.16141 WP_003404823.1.16143 WP_003404823.1.1630 WP_003404823.1.16318 WP_003404823.1.1632 WP_003404823.1.16327 WP_003404823.1.16334 WP_003404823.1.16341 WP_003404823.1.16345 WP_003404823.1.16374 WP_003404823.1.16384 WP_003404823.1.16386 WP_003404823.1.164 WP_003404823.1.1642 WP_003404823.1.16421 WP_003404823.1.16426 WP_003404823.1.16431 WP_003404823.1.16438 WP_003404823.1.16442 WP_003404823.1.16448 WP_003404823.1.16451 WP_003404823.1.16476 WP_003404823.1.16480 WP_003404823.1.16494 WP_003404823.1.1652 WP_003404823.1.16549 WP_003404823.1.16560 WP_003404823.1.16598 WP_003404823.1.16619 WP_003404823.1.16620 WP_003404823.1.16622 WP_003404823.1.16637 WP_003404823.1.1669 WP_003404823.1.16707 WP_003404823.1.16724 WP_003404823.1.16731 WP_003404823.1.16743 WP_003404823.1.1683 WP_003404823.1.16837 WP_003404823.1.16852 WP_003404823.1.16937 WP_003404823.1.16940 WP_003404823.1.16950 WP_003404823.1.16959 WP_003404823.1.16968 WP_003404823.1.1697 WP_003404823.1.16973 WP_003404823.1.16977 WP_003404823.1.16987 WP_003404823.1.17005 WP_003404823.1.17006 WP_003404823.1.17010 WP_003404823.1.17015 WP_003404823.1.17019 WP_003404823.1.17039 WP_003404823.1.17041 WP_003404823.1.17052 WP_003404823.1.17057 WP_003404823.1.17062 WP_003404823.1.1707 WP_003404823.1.17094 WP_003404823.1.17130 WP_003404823.1.17138 WP_003404823.1.17147 WP_003404823.1.17167 WP_003404823.1.17224 WP_003404823.1.17251 WP_003404823.1.17288 WP_003404823.1.17304 WP_003404823.1.17314 WP_003404823.1.17381 WP_003404823.1.17391 WP_003404823.1.17412 WP_003404823.1.1743 WP_003404823.1.17440 WP_003404823.1.17466 WP_003404823.1.17477 WP_003404823.1.17483 WP_003404823.1.17505 WP_003404823.1.17527 WP_003404823.1.17535 WP_003404823.1.17540 WP_003404823.1.17553 WP_003404823.1.17558 WP_003404823.1.17599 WP_003404823.1.17655 WP_003404823.1.17679 WP_003404823.1.1768 WP_003404823.1.17687 WP_003404823.1.17700 WP_003404823.1.17710 WP_003404823.1.17713 WP_003404823.1.17722 WP_003404823.1.17746 WP_003404823.1.17788 WP_003404823.1.17798 WP_003404823.1.17803 WP_003404823.1.17816 WP_003404823.1.17821 WP_003404823.1.17830 WP_003404823.1.17868 WP_003404823.1.17878 WP_003404823.1.1792 WP_003404823.1.17923 WP_003404823.1.1795 WP_003404823.1.17955 WP_003404823.1.17973 WP_003404823.1.18009 WP_003404823.1.18013 WP_003404823.1.18033 WP_003404823.1.18057 WP_003404823.1.18070 WP_003404823.1.18116 WP_003404823.1.18120 WP_003404823.1.18126 WP_003404823.1.1817 WP_003404823.1.18170 WP_003404823.1.18206 WP_003404823.1.18240 WP_003404823.1.18257 WP_003404823.1.18297 WP_003404823.1.18306 WP_003404823.1.18364 WP_003404823.1.18399 WP_003404823.1.18411 WP_003404823.1.18444 WP_003404823.1.18448 WP_003404823.1.18467 WP_003404823.1.18476 WP_003404823.1.18522 WP_003404823.1.18580 WP_003404823.1.18582 WP_003404823.1.18587 WP_003404823.1.186 WP_003404823.1.18601 WP_003404823.1.18639 WP_003404823.1.18646 WP_003404823.1.18647 WP_003404823.1.1868 WP_003404823.1.18694 WP_003404823.1.18710 WP_003404823.1.18751 WP_003404823.1.18781 WP_003404823.1.18793 WP_003404823.1.18804 WP_003404823.1.18816 WP_003404823.1.18823 WP_003404823.1.18827 WP_003404823.1.18838 WP_003404823.1.18849 WP_003404823.1.18856 WP_003404823.1.18945 WP_003404823.1.1898 WP_003404823.1.19005 WP_003404823.1.19056 WP_003404823.1.19063 WP_003404823.1.19066 WP_003404823.1.19085 WP_003404823.1.19094 WP_003404823.1.19144 WP_003404823.1.19159 WP_003404823.1.19193 WP_003404823.1.19231 WP_003404823.1.19243 WP_003404823.1.19264 WP_003404823.1.19295 WP_003404823.1.19307 WP_003404823.1.19326 WP_003404823.1.1933 WP_003404823.1.19364 WP_003404823.1.19382 WP_003404823.1.19400 WP_003404823.1.19426 WP_003404823.1.19429 WP_003404823.1.19464 WP_003404823.1.19480 WP_003404823.1.19512 WP_003404823.1.19553 WP_003404823.1.19562 WP_003404823.1.19564 WP_003404823.1.19568 WP_003404823.1.19572 WP_003404823.1.19595 WP_003404823.1.19596 WP_003404823.1.19600 WP_003404823.1.19630 WP_003404823.1.1967 WP_003404823.1.19694 WP_003404823.1.1970 WP_003404823.1.19707 WP_003404823.1.19742 WP_003404823.1.19785 WP_003404823.1.19820 WP_003404823.1.19868 WP_003404823.1.19874 WP_003404823.1.19890 WP_003404823.1.19900 WP_003404823.1.19922 WP_003404823.1.19936 WP_003404823.1.19946 WP_003404823.1.19949 WP_003404823.1.19960 WP_003404823.1.19964 WP_003404823.1.20007 WP_003404823.1.20016 WP_003404823.1.20028 WP_003404823.1.2003 WP_003404823.1.20037 WP_003404823.1.20039 WP_003404823.1.20082 WP_003404823.1.20085 WP_003404823.1.20097 WP_003404823.1.20116 WP_003404823.1.20130 WP_003404823.1.20140 WP_003404823.1.20141 WP_003404823.1.20142 WP_003404823.1.20158 WP_003404823.1.20239 WP_003404823.1.20243 WP_003404823.1.20259 WP_003404823.1.20262 WP_003404823.1.20268 WP_003404823.1.20272 WP_003404823.1.20273 WP_003404823.1.20280 WP_003404823.1.20294 WP_003404823.1.20309 WP_003404823.1.20322 WP_003404823.1.2037 WP_003404823.1.20372 WP_003404823.1.20381 WP_003404823.1.204 WP_003404823.1.20427 WP_003404823.1.20432 WP_003404823.1.20457 WP_003404823.1.20459 WP_003404823.1.20460 WP_003404823.1.20542 WP_003404823.1.20578 WP_003404823.1.20608 WP_003404823.1.20624 WP_003404823.1.20628 WP_003404823.1.2066 WP_003404823.1.20707 WP_003404823.1.20722 WP_003404823.1.20729 WP_003404823.1.20742 WP_003404823.1.20751 WP_003404823.1.20776 WP_003404823.1.20843 WP_003404823.1.20850 WP_003404823.1.2086 WP_003404823.1.20868 WP_003404823.1.20876 WP_003404823.1.20897 WP_003404823.1.20898 WP_003404823.1.2090 WP_003404823.1.20911 WP_003404823.1.20916 WP_003404823.1.20921 WP_003404823.1.20927 WP_003404823.1.20951 WP_003404823.1.20970 WP_003404823.1.21070 WP_003404823.1.21127 WP_003404823.1.21135 WP_003404823.1.21173 WP_003404823.1.21187 WP_003404823.1.212 WP_003404823.1.2120 WP_003404823.1.21218 WP_003404823.1.21219 WP_003404823.1.2123 WP_003404823.1.21231 WP_003404823.1.21234 WP_003404823.1.2126 WP_003404823.1.21292 WP_003404823.1.21307 WP_003404823.1.2131 WP_003404823.1.21311 WP_003404823.1.21321 WP_003404823.1.21365 WP_003404823.1.2137 WP_003404823.1.21392 WP_003404823.1.21397 WP_003404823.1.21415 WP_003404823.1.21434 WP_003404823.1.21444 WP_003404823.1.21468 WP_003404823.1.21498 WP_003404823.1.21509 WP_003404823.1.21513 WP_003404823.1.21560 WP_003404823.1.21565 WP_003404823.1.21586 WP_003404823.1.21591 WP_003404823.1.21594 WP_003404823.1.21602 WP_003404823.1.21615 WP_003404823.1.21638 WP_003404823.1.21639 WP_003404823.1.21655 WP_003404823.1.21658 WP_003404823.1.2168 WP_003404823.1.2174 WP_003404823.1.21741 WP_003404823.1.21742 WP_003404823.1.21777 WP_003404823.1.21786 WP_003404823.1.218 WP_003404823.1.21826 WP_003404823.1.21829 WP_003404823.1.21843 WP_003404823.1.21872 WP_003404823.1.2188 WP_003404823.1.21882 WP_003404823.1.21906 WP_003404823.1.21912 WP_003404823.1.2194 WP_003404823.1.21941 WP_003404823.1.21956 WP_003404823.1.21958 WP_003404823.1.21960 WP_003404823.1.21971 WP_003404823.1.21973 WP_003404823.1.21983 WP_003404823.1.22003 WP_003404823.1.22013 WP_003404823.1.22025 WP_003404823.1.22036 WP_003404823.1.22075 WP_003404823.1.22092 WP_003404823.1.2212 WP_003404823.1.22127 WP_003404823.1.22140 WP_003404823.1.22233 WP_003404823.1.22255 WP_003404823.1.22277 WP_003404823.1.22305 WP_003404823.1.22348 WP_003404823.1.22356 WP_003404823.1.22366 WP_003404823.1.2238 WP_003404823.1.22380 WP_003404823.1.22437 WP_003404823.1.22438 WP_003404823.1.22445 WP_003404823.1.22490 WP_003404823.1.22511 WP_003404823.1.22524 WP_003404823.1.2253 WP_003404823.1.22585 WP_003404823.1.22589 WP_003404823.1.22606 WP_003404823.1.22608 WP_003404823.1.22609 WP_003404823.1.22618 WP_003404823.1.2262 WP_003404823.1.22624 WP_003404823.1.22629 WP_003404823.1.22647 WP_003404823.1.22664 WP_003404823.1.22665 WP_003404823.1.22670 WP_003404823.1.22674 WP_003404823.1.22680 WP_003404823.1.22725 WP_003404823.1.22728 WP_003404823.1.22733 WP_003404823.1.22737 WP_003404823.1.2275 WP_003404823.1.22754 WP_003404823.1.22797 WP_003404823.1.22800 WP_003404823.1.22804 WP_003404823.1.22829 WP_003404823.1.22840 WP_003404823.1.22844 WP_003404823.1.22963 WP_003404823.1.22970 WP_003404823.1.22996 WP_003404823.1.22997 WP_003404823.1.22999 WP_003404823.1.23015 WP_003404823.1.23032 WP_003404823.1.23101 WP_003404823.1.2312 WP_003404823.1.23140 WP_003404823.1.23153 WP_003404823.1.23171 WP_003404823.1.23199 WP_003404823.1.2320 WP_003404823.1.23204 WP_003404823.1.23216 WP_003404823.1.23229 WP_003404823.1.23233 WP_003404823.1.2326 WP_003404823.1.23261 WP_003404823.1.23289 WP_003404823.1.2329 WP_003404823.1.23308 WP_003404823.1.23316 WP_003404823.1.23321 WP_003404823.1.23325 WP_003404823.1.2339 WP_003404823.1.23406 WP_003404823.1.23438 WP_003404823.1.23445 WP_003404823.1.23447 WP_003404823.1.23452 WP_003404823.1.23461 WP_003404823.1.2349 WP_003404823.1.23496 WP_003404823.1.23497 WP_003404823.1.23506 WP_003404823.1.23530 WP_003404823.1.23539 WP_003404823.1.23546 WP_003404823.1.23551 WP_003404823.1.23573 WP_003404823.1.23583 WP_003404823.1.23588 WP_003404823.1.23628 WP_003404823.1.23677 WP_003404823.1.23683 WP_003404823.1.23692 WP_003404823.1.23694 WP_003404823.1.23699 WP_003404823.1.2371 WP_003404823.1.23803 WP_003404823.1.23807 WP_003404823.1.23825 WP_003404823.1.23832 WP_003404823.1.2384 WP_003404823.1.23843 WP_003404823.1.23863 WP_003404823.1.2387 WP_003404823.1.23894 WP_003404823.1.23993 WP_003404823.1.2400 WP_003404823.1.24007 WP_003404823.1.24008 WP_003404823.1.24057 WP_003404823.1.24062 WP_003404823.1.24113 WP_003404823.1.24119 WP_003404823.1.24128 WP_003404823.1.24140 WP_003404823.1.24176 WP_003404823.1.24190 WP_003404823.1.24202 WP_003404823.1.24244 WP_003404823.1.24261 WP_003404823.1.24284 WP_003404823.1.24294 WP_003404823.1.24357 WP_003404823.1.24396 WP_003404823.1.24414 WP_003404823.1.24423 WP_003404823.1.2443 WP_003404823.1.24446 WP_003404823.1.24461 WP_003404823.1.24500 WP_003404823.1.24507 WP_003404823.1.24509 WP_003404823.1.24529 WP_003404823.1.24553 WP_003404823.1.24599 WP_003404823.1.24629 WP_003404823.1.24638 WP_003404823.1.24648 WP_003404823.1.2466 WP_003404823.1.24767 WP_003404823.1.24824 WP_003404823.1.24831 WP_003404823.1.24840 WP_003404823.1.24848 WP_003404823.1.24857 WP_003404823.1.2487 WP_003404823.1.24893 WP_003404823.1.24907 WP_003404823.1.24933 WP_003404823.1.24956 WP_003404823.1.24958 WP_003404823.1.24985 WP_003404823.1.2499 WP_003404823.1.25004 WP_003404823.1.2505 WP_003404823.1.25051 WP_003404823.1.2507 WP_003404823.1.25096 WP_003404823.1.25103 WP_003404823.1.25129 WP_003404823.1.25171 WP_003404823.1.25184 WP_003404823.1.25247 WP_003404823.1.25252 WP_003404823.1.25278 WP_003404823.1.25283 WP_003404823.1.25309 WP_003404823.1.25313 WP_003404823.1.25338 WP_003404823.1.25342 WP_003404823.1.25343 WP_003404823.1.25367 WP_003404823.1.25393 WP_003404823.1.25406 WP_003404823.1.25435 WP_003404823.1.25437 WP_003404823.1.25445 WP_003404823.1.25455 WP_003404823.1.25473 WP_003404823.1.25504 WP_003404823.1.25513 WP_003404823.1.25542 WP_003404823.1.25579 WP_003404823.1.25594 WP_003404823.1.25606 WP_003404823.1.25645 WP_003404823.1.2566 WP_003404823.1.25673 WP_003404823.1.25674 WP_003404823.1.25693 WP_003404823.1.25699 WP_003404823.1.25727 WP_003404823.1.25736 WP_003404823.1.25738 WP_003404823.1.25756 WP_003404823.1.25759 WP_003404823.1.2580 WP_003404823.1.25813 WP_003404823.1.25853 WP_003404823.1.25854 WP_003404823.1.25874 WP_003404823.1.25885 WP_003404823.1.25892 WP_003404823.1.25906 WP_003404823.1.25914 WP_003404823.1.25916 WP_003404823.1.2594 WP_003404823.1.25954 WP_003404823.1.25965 WP_003404823.1.25972 WP_003404823.1.26017 WP_003404823.1.26032 WP_003404823.1.26038 WP_003404823.1.26072 WP_003404823.1.26097 WP_003404823.1.26098 WP_003404823.1.26108 WP_003404823.1.26109 WP_003404823.1.26118 WP_003404823.1.26126 WP_003404823.1.2614 WP_003404823.1.26168 WP_003404823.1.26182 WP_003404823.1.26190 WP_003404823.1.2620 WP_003404823.1.26234 WP_003404823.1.26243 WP_003404823.1.26265 WP_003404823.1.26267 WP_003404823.1.26292 WP_003404823.1.26310 WP_003404823.1.26328 WP_003404823.1.26349 WP_003404823.1.26366 WP_003404823.1.26374 WP_003404823.1.26407 WP_003404823.1.26412 WP_003404823.1.26454 WP_003404823.1.26464 WP_003404823.1.2653 WP_003404823.1.26560 WP_003404823.1.26571 WP_003404823.1.2659 WP_003404823.1.26597 WP_003404823.1.26603 WP_003404823.1.26629 WP_003404823.1.26651 WP_003404823.1.26702 WP_003404823.1.26707 WP_003404823.1.26710 WP_003404823.1.26737 WP_003404823.1.26738 WP_003404823.1.26745 WP_003404823.1.26756 WP_003404823.1.2676 WP_003404823.1.2677 WP_003404823.1.26779 WP_003404823.1.26780 WP_003404823.1.26798 WP_003404823.1.26854 WP_003404823.1.26868 WP_003404823.1.26876 WP_003404823.1.26888 WP_003404823.1.26914 WP_003404823.1.26945 WP_003404823.1.26959 WP_003404823.1.26969 WP_003404823.1.26984 WP_003404823.1.26992 WP_003404823.1.27004 WP_003404823.1.27017 WP_003404823.1.27045 WP_003404823.1.27074 WP_003404823.1.27075 WP_003404823.1.27128 WP_003404823.1.27130 WP_003404823.1.27139 WP_003404823.1.27152 WP_003404823.1.27162 WP_003404823.1.27164 WP_003404823.1.27193 WP_003404823.1.27235 WP_003404823.1.27254 WP_003404823.1.27278 WP_003404823.1.27343 WP_003404823.1.27352 WP_003404823.1.27369 WP_003404823.1.27391 WP_003404823.1.27398 WP_003404823.1.27410 WP_003404823.1.27411 WP_003404823.1.27449 WP_003404823.1.27460 WP_003404823.1.27463 WP_003404823.1.2749 WP_003404823.1.27492 WP_003404823.1.27528 WP_003404823.1.27541 WP_003404823.1.27576 WP_003404823.1.27582 WP_003404823.1.27596 WP_003404823.1.27607 WP_003404823.1.2766 WP_003404823.1.277 WP_003404823.1.27730 WP_003404823.1.27736 WP_003404823.1.27743 WP_003404823.1.27750 WP_003404823.1.27771 WP_003404823.1.27779 WP_003404823.1.27795 WP_003404823.1.27803 WP_003404823.1.27819 WP_003404823.1.27835 WP_003404823.1.27915 WP_003404823.1.27935 WP_003404823.1.27962 WP_003404823.1.28053 WP_003404823.1.28092 WP_003404823.1.28106 WP_003404823.1.28131 WP_003404823.1.28142 WP_003404823.1.28159 WP_003404823.1.2816 WP_003404823.1.28161 WP_003404823.1.28192 WP_003404823.1.28202 WP_003404823.1.28241 WP_003404823.1.28242 WP_003404823.1.28251 WP_003404823.1.28255 WP_003404823.1.28269 WP_003404823.1.28293 WP_003404823.1.28331 WP_003404823.1.28367 WP_003404823.1.28378 WP_003404823.1.2842 WP_003404823.1.28448 WP_003404823.1.28471 WP_003404823.1.28473 WP_003404823.1.28493 WP_003404823.1.28497 WP_003404823.1.28530 WP_003404823.1.28545 WP_003404823.1.28561 WP_003404823.1.28567 WP_003404823.1.28585 WP_003404823.1.286 WP_003404823.1.28610 WP_003404823.1.28617 WP_003404823.1.28634 WP_003404823.1.28642 WP_003404823.1.28671 WP_003404823.1.28682 WP_003404823.1.28698 WP_003404823.1.28703 WP_003404823.1.28739 WP_003404823.1.28758 WP_003404823.1.28781 WP_003404823.1.28787 WP_003404823.1.28827 WP_003404823.1.28839 WP_003404823.1.28847 WP_003404823.1.28850 WP_003404823.1.28851 WP_003404823.1.28865 WP_003404823.1.28897 WP_003404823.1.28914 WP_003404823.1.28935 WP_003404823.1.28936 WP_003404823.1.28939 WP_003404823.1.28943 WP_003404823.1.28952 WP_003404823.1.28975 WP_003404823.1.2899 WP_003404823.1.28993 WP_003404823.1.29000 WP_003404823.1.2901 WP_003404823.1.29033 WP_003404823.1.29058 WP_003404823.1.29078 WP_003404823.1.29102 WP_003404823.1.29115 WP_003404823.1.2916 WP_003404823.1.29217 WP_003404823.1.29223 WP_003404823.1.29234 WP_003404823.1.29264 WP_003404823.1.29275 WP_003404823.1.29306 WP_003404823.1.29339 WP_003404823.1.29348 WP_003404823.1.29364 WP_003404823.1.29367 WP_003404823.1.2938 WP_003404823.1.29399 WP_003404823.1.29426 WP_003404823.1.2944 WP_003404823.1.29449 WP_003404823.1.29450 WP_003404823.1.29452 WP_003404823.1.2949 WP_003404823.1.29510 WP_003404823.1.29515 WP_003404823.1.29525 WP_003404823.1.2953 WP_003404823.1.29559 WP_003404823.1.29587 WP_003404823.1.2959 WP_003404823.1.29592 WP_003404823.1.29599 WP_003404823.1.29611 WP_003404823.1.29632 WP_003404823.1.29649 WP_003404823.1.2965 WP_003404823.1.29659 WP_003404823.1.2969 WP_003404823.1.29696 WP_003404823.1.29698 WP_003404823.1.29718 WP_003404823.1.29742 WP_003404823.1.29745 WP_003404823.1.29747 WP_003404823.1.29769 WP_003404823.1.29825 WP_003404823.1.29830 WP_003404823.1.29847 WP_003404823.1.29861 WP_003404823.1.29869 WP_003404823.1.29883 WP_003404823.1.29890 WP_003404823.1.299 WP_003404823.1.29931 WP_003404823.1.30014 WP_003404823.1.3004 WP_003404823.1.30040 WP_003404823.1.30043 WP_003404823.1.30074 WP_003404823.1.30097 WP_003404823.1.30101 WP_003404823.1.30106 WP_003404823.1.30114 WP_003404823.1.30126 WP_003404823.1.30131 WP_003404823.1.30138 WP_003404823.1.30139 WP_003404823.1.30145 WP_003404823.1.30211 WP_003404823.1.30224 WP_003404823.1.30235 WP_003404823.1.30237 WP_003404823.1.3027 WP_003404823.1.30279 WP_003404823.1.30282 WP_003404823.1.30283 WP_003404823.1.30288 WP_003404823.1.30291 WP_003404823.1.30363 WP_003404823.1.30374 WP_003404823.1.30404 WP_003404823.1.3043 WP_003404823.1.30433 WP_003404823.1.30438 WP_003404823.1.30462 WP_003404823.1.30464 WP_003404823.1.30468 WP_003404823.1.30500 WP_003404823.1.3057 WP_003404823.1.30574 WP_003404823.1.30628 WP_003404823.1.30641 WP_003404823.1.30642 WP_003404823.1.30661 WP_003404823.1.30669 WP_003404823.1.30683 WP_003404823.1.30699 WP_003404823.1.30709 WP_003404823.1.30713 WP_003404823.1.30716 WP_003404823.1.30719 WP_003404823.1.30730 WP_003404823.1.30732 WP_003404823.1.30736 WP_003404823.1.30745 WP_003404823.1.30760 WP_003404823.1.30791 WP_003404823.1.308 WP_003404823.1.30807 WP_003404823.1.30818 WP_003404823.1.30824 WP_003404823.1.30848 WP_003404823.1.30877 WP_003404823.1.30888 WP_003404823.1.30901 WP_003404823.1.30903 WP_003404823.1.30912 WP_003404823.1.30913 WP_003404823.1.30914 WP_003404823.1.30919 WP_003404823.1.30977 WP_003404823.1.3100 WP_003404823.1.31002 WP_003404823.1.3101 WP_003404823.1.31034 WP_003404823.1.31047 WP_003404823.1.31070 WP_003404823.1.31074 WP_003404823.1.31102 WP_003404823.1.31127 WP_003404823.1.31184 WP_003404823.1.31199 WP_003404823.1.31226 WP_003404823.1.31230 WP_003404823.1.31233 WP_003404823.1.31263 WP_003404823.1.31264 WP_003404823.1.31270 WP_003404823.1.31287 WP_003404823.1.31290 WP_003404823.1.31304 WP_003404823.1.31346 WP_003404823.1.31354 WP_003404823.1.31390 WP_003404823.1.31414 WP_003404823.1.31417 WP_003404823.1.31428 WP_003404823.1.3143 WP_003404823.1.31483 WP_003404823.1.3149 WP_003404823.1.31498 WP_003404823.1.31507 WP_003404823.1.31537 WP_003404823.1.31548 WP_003404823.1.31569 WP_003404823.1.316 WP_003404823.1.31629 WP_003404823.1.31666 WP_003404823.1.31693 WP_003404823.1.31703 WP_003404823.1.31744 WP_003404823.1.31745 WP_003404823.1.31770 WP_003404823.1.31776 WP_003404823.1.31783 WP_003404823.1.318 WP_003404823.1.3184 WP_003404823.1.31840 WP_003404823.1.31880 WP_003404823.1.31911 WP_003404823.1.31930 WP_003404823.1.31932 WP_003404823.1.31955 WP_003404823.1.31985 WP_003404823.1.31991 WP_003404823.1.31995 WP_003404823.1.32004 WP_003404823.1.32039 WP_003404823.1.3204 WP_003404823.1.32045 WP_003404823.1.32071 WP_003404823.1.32098 WP_003404823.1.32132 WP_003404823.1.32157 WP_003404823.1.32164 WP_003404823.1.32179 WP_003404823.1.32198 WP_003404823.1.32297 WP_003404823.1.32317 WP_003404823.1.32383 WP_003404823.1.32400 WP_003404823.1.32403 WP_003404823.1.32416 WP_003404823.1.32421 WP_003404823.1.32433 WP_003404823.1.32461 WP_003404823.1.32503 WP_003404823.1.32556 WP_003404823.1.32562 WP_003404823.1.32569 WP_003404823.1.32592 WP_003404823.1.32620 WP_003404823.1.32647 WP_003404823.1.32653 WP_003404823.1.32654 WP_003404823.1.3268 WP_003404823.1.32695 WP_003404823.1.32706 WP_003404823.1.32716 WP_003404823.1.32738 WP_003404823.1.32752 WP_003404823.1.32780 WP_003404823.1.32781 WP_003404823.1.32793 WP_003404823.1.32799 WP_003404823.1.32822 WP_003404823.1.32833 WP_003404823.1.32862 WP_003404823.1.32880 WP_003404823.1.32897 WP_003404823.1.32909 WP_003404823.1.32935 WP_003404823.1.32974 WP_003404823.1.33007 WP_003404823.1.3302 WP_003404823.1.33028 WP_003404823.1.33035 WP_003404823.1.33044 WP_003404823.1.33054 WP_003404823.1.33082 WP_003404823.1.33141 WP_003404823.1.33148 WP_003404823.1.33155 WP_003404823.1.33168 WP_003404823.1.3321 WP_003404823.1.33215 WP_003404823.1.3325 WP_003404823.1.3327 WP_003404823.1.33278 WP_003404823.1.33288 WP_003404823.1.3331 WP_003404823.1.33319 WP_003404823.1.3333 WP_003404823.1.33393 WP_003404823.1.33403 WP_003404823.1.33452 WP_003404823.1.33467 WP_003404823.1.33477 WP_003404823.1.3349 WP_003404823.1.33519 WP_003404823.1.33542 WP_003404823.1.33601 WP_003404823.1.33602 WP_003404823.1.33633 WP_003404823.1.33646 WP_003404823.1.33673 WP_003404823.1.3369 WP_003404823.1.33705 WP_003404823.1.33762 WP_003404823.1.33783 WP_003404823.1.33789 WP_003404823.1.3383 WP_003404823.1.33832 WP_003404823.1.33839 WP_003404823.1.33848 WP_003404823.1.3387 WP_003404823.1.33886 WP_003404823.1.33895 WP_003404823.1.33906 WP_003404823.1.33912 WP_003404823.1.33954 WP_003404823.1.3399 WP_003404823.1.34042 WP_003404823.1.3405 WP_003404823.1.34055 WP_003404823.1.34056 WP_003404823.1.34065 WP_003404823.1.3408 WP_003404823.1.34090 WP_003404823.1.34109 WP_003404823.1.34111 WP_003404823.1.34131 WP_003404823.1.34152 WP_003404823.1.34153 WP_003404823.1.34181 WP_003404823.1.34197 WP_003404823.1.34198 WP_003404823.1.34215 WP_003404823.1.34219 WP_003404823.1.34255 WP_003404823.1.34260 WP_003404823.1.34275 WP_003404823.1.343 WP_003404823.1.34347 WP_003404823.1.34358 WP_003404823.1.34392 WP_003404823.1.344 WP_003404823.1.34428 WP_003404823.1.3443 WP_003404823.1.34435 WP_003404823.1.34446 WP_003404823.1.34499 WP_003404823.1.34505 WP_003404823.1.34516 WP_003404823.1.34529 WP_003404823.1.34551 WP_003404823.1.34563 WP_003404823.1.34576 WP_003404823.1.34581 WP_003404823.1.34588 WP_003404823.1.34596 WP_003404823.1.34599 WP_003404823.1.34639 WP_003404823.1.34673 WP_003404823.1.34724 WP_003404823.1.34740 WP_003404823.1.34755 WP_003404823.1.34777 WP_003404823.1.34783 WP_003404823.1.34841 WP_003404823.1.34908 WP_003404823.1.34919 WP_003404823.1.3492 WP_003404823.1.34933 WP_003404823.1.34945 WP_003404823.1.34946 WP_003404823.1.34954 WP_003404823.1.34960 WP_003404823.1.34961 WP_003404823.1.34965 WP_003404823.1.34968 WP_003404823.1.35023 WP_003404823.1.35069 WP_003404823.1.35072 WP_003404823.1.35078 WP_003404823.1.35100 WP_003404823.1.35146 WP_003404823.1.35156 WP_003404823.1.35160 WP_003404823.1.35162 WP_003404823.1.35173 WP_003404823.1.35176 WP_003404823.1.3520 WP_003404823.1.35213 WP_003404823.1.35221 WP_003404823.1.35246 WP_003404823.1.35278 WP_003404823.1.35301 WP_003404823.1.35311 WP_003404823.1.35312 WP_003404823.1.35317 WP_003404823.1.35319 WP_003404823.1.35347 WP_003404823.1.35363 WP_003404823.1.35382 WP_003404823.1.35385 WP_003404823.1.35397 WP_003404823.1.35403 WP_003404823.1.35426 WP_003404823.1.35439 WP_003404823.1.35455 WP_003404823.1.3548 WP_003404823.1.35484 WP_003404823.1.35492 WP_003404823.1.3553 WP_003404823.1.35553 WP_003404823.1.35555 WP_003404823.1.35561 WP_003404823.1.35602 WP_003404823.1.35610 WP_003404823.1.35635 WP_003404823.1.35657 WP_003404823.1.35680 WP_003404823.1.35687 WP_003404823.1.35689 WP_003404823.1.35707 WP_003404823.1.35732 WP_003404823.1.35754 WP_003404823.1.35767 WP_003404823.1.35770 WP_003404823.1.35771 WP_003404823.1.35780 WP_003404823.1.35805 WP_003404823.1.35811 WP_003404823.1.35821 WP_003404823.1.3584 WP_003404823.1.35848 WP_003404823.1.35864 WP_003404823.1.35874 WP_003404823.1.35876 WP_003404823.1.35897 WP_003404823.1.35899 WP_003404823.1.35923 WP_003404823.1.3593 WP_003404823.1.35954 WP_003404823.1.36005 WP_003404823.1.36014 WP_003404823.1.36023 WP_003404823.1.36051 WP_003404823.1.36053 WP_003404823.1.36075 WP_003404823.1.36089 WP_003404823.1.36097 WP_003404823.1.36098 WP_003404823.1.36116 WP_003404823.1.36145 WP_003404823.1.36156 WP_003404823.1.36205 WP_003404823.1.36228 WP_003404823.1.36246 WP_003404823.1.36252 WP_003404823.1.36260 WP_003404823.1.36270 WP_003404823.1.36271 WP_003404823.1.36303 WP_003404823.1.36309 WP_003404823.1.36315 WP_003404823.1.36319 WP_003404823.1.36321 WP_003404823.1.36326 WP_003404823.1.3634 WP_003404823.1.36356 WP_003404823.1.36357 WP_003404823.1.3636 WP_003404823.1.36385 WP_003404823.1.36399 WP_003404823.1.36436 WP_003404823.1.36465 WP_003404823.1.36469 WP_003404823.1.36485 WP_003404823.1.36508 WP_003404823.1.36540 WP_003404823.1.36561 WP_003404823.1.36571 WP_003404823.1.36573 WP_003404823.1.36578 WP_003404823.1.36585 WP_003404823.1.36597 WP_003404823.1.36614 WP_003404823.1.36657 WP_003404823.1.36674 WP_003404823.1.36720 WP_003404823.1.36727 WP_003404823.1.36733 WP_003404823.1.36785 WP_003404823.1.36810 WP_003404823.1.36844 WP_003404823.1.36851 WP_003404823.1.36862 WP_003404823.1.36893 WP_003404823.1.36901 WP_003404823.1.36935 WP_003404823.1.36941 WP_003404823.1.3695 WP_003404823.1.36951 WP_003404823.1.36968 WP_003404823.1.3700 WP_003404823.1.37004 WP_003404823.1.37012 WP_003404823.1.37071 WP_003404823.1.37088 WP_003404823.1.37131 WP_003404823.1.37157 WP_003404823.1.37175 WP_003404823.1.37188 WP_003404823.1.37213 WP_003404823.1.37229 WP_003404823.1.3724 WP_003404823.1.37277 WP_003404823.1.37305 WP_003404823.1.37330 WP_003404823.1.37389 WP_003404823.1.37400 WP_003404823.1.37440 WP_003404823.1.37459 WP_003404823.1.37468 WP_003404823.1.37475 WP_003404823.1.37484 WP_003404823.1.37601 WP_003404823.1.37612 WP_003404823.1.37632 WP_003404823.1.37643 WP_003404823.1.37655 WP_003404823.1.37660 WP_003404823.1.37674 WP_003404823.1.37700 WP_003404823.1.37701 WP_003404823.1.37709 WP_003404823.1.37711 WP_003404823.1.37721 WP_003404823.1.37722 WP_003404823.1.37747 WP_003404823.1.37765 WP_003404823.1.37772 WP_003404823.1.37804 WP_003404823.1.37809 WP_003404823.1.37859 WP_003404823.1.37877 WP_003404823.1.37912 WP_003404823.1.37913 WP_003404823.1.37943 WP_003404823.1.37950 WP_003404823.1.37973 WP_003404823.1.37975 WP_003404823.1.37983 WP_003404823.1.38 WP_003404823.1.38002 WP_003404823.1.3802 WP_003404823.1.38039 WP_003404823.1.38040 WP_003404823.1.38067 WP_003404823.1.38068 WP_003404823.1.38135 WP_003404823.1.38138 WP_003404823.1.38144 WP_003404823.1.38158 WP_003404823.1.38159 WP_003404823.1.38210 WP_003404823.1.38233 WP_003404823.1.38240 WP_003404823.1.38299 WP_003404823.1.38332 WP_003404823.1.38347 WP_003404823.1.38354 WP_003404823.1.38380 WP_003404823.1.38384 WP_003404823.1.38389 WP_003404823.1.38398 WP_003404823.1.38402 WP_003404823.1.38418 WP_003404823.1.38421 WP_003404823.1.38466 WP_003404823.1.38477 WP_003404823.1.38483 WP_003404823.1.3849 WP_003404823.1.385 WP_003404823.1.38530 WP_003404823.1.38535 WP_003404823.1.38539 WP_003404823.1.38594 WP_003404823.1.38601 WP_003404823.1.38638 WP_003404823.1.38639 WP_003404823.1.38646 WP_003404823.1.38648 WP_003404823.1.38654 WP_003404823.1.38659 WP_003404823.1.38660 WP_003404823.1.38666 WP_003404823.1.38671 WP_003404823.1.38672 WP_003404823.1.38677 WP_003404823.1.38750 WP_003404823.1.38772 WP_003404823.1.38812 WP_003404823.1.38821 WP_003404823.1.38844 WP_003404823.1.38863 WP_003404823.1.38873 WP_003404823.1.3889 WP_003404823.1.38894 WP_003404823.1.38909 WP_003404823.1.38939 WP_003404823.1.38974 WP_003404823.1.38975 WP_003404823.1.38991 WP_003404823.1.39025 WP_003404823.1.39070 WP_003404823.1.39072 WP_003404823.1.39095 WP_003404823.1.39106 WP_003404823.1.39165 WP_003404823.1.39174 WP_003404823.1.39176 WP_003404823.1.39178 WP_003404823.1.39190 WP_003404823.1.39201 WP_003404823.1.39207 WP_003404823.1.39211 WP_003404823.1.39236 WP_003404823.1.39239 WP_003404823.1.39252 WP_003404823.1.39288 WP_003404823.1.39295 WP_003404823.1.39306 WP_003404823.1.39359 WP_003404823.1.39364 WP_003404823.1.39400 WP_003404823.1.39447 WP_003404823.1.3945 WP_003404823.1.39450 WP_003404823.1.3949 WP_003404823.1.39521 WP_003404823.1.39560 WP_003404823.1.39592 WP_003404823.1.39593 WP_003404823.1.396 WP_003404823.1.3960 WP_003404823.1.39616 WP_003404823.1.39654 WP_003404823.1.39657 WP_003404823.1.39661 WP_003404823.1.39674 WP_003404823.1.39678 WP_003404823.1.3968 WP_003404823.1.39694 WP_003404823.1.3971 WP_003404823.1.39728 WP_003404823.1.39739 WP_003404823.1.39748 WP_003404823.1.39751 WP_003404823.1.39759 WP_003404823.1.39801 WP_003404823.1.39804 WP_003404823.1.39848 WP_003404823.1.39877 WP_003404823.1.39925 WP_003404823.1.3994 WP_003404823.1.39959 WP_003404823.1.3996 WP_003404823.1.39960 WP_003404823.1.3997 WP_003404823.1.39980 WP_003404823.1.40000 WP_003404823.1.40028 WP_003404823.1.40029 WP_003404823.1.4003 WP_003404823.1.40094 WP_003404823.1.40096 WP_003404823.1.40150 WP_003404823.1.40156 WP_003404823.1.40174 WP_003404823.1.40186 WP_003404823.1.40276 WP_003404823.1.40277 WP_003404823.1.40323 WP_003404823.1.40336 WP_003404823.1.40353 WP_003404823.1.4036 WP_003404823.1.40402 WP_003404823.1.40413 WP_003404823.1.40440 WP_003404823.1.40446 WP_003404823.1.40451 WP_003404823.1.40455 WP_003404823.1.40523 WP_003404823.1.40543 WP_003404823.1.40641 WP_003404823.1.40646 WP_003404823.1.40651 WP_003404823.1.40653 WP_003404823.1.40705 WP_003404823.1.40723 WP_003404823.1.40731 WP_003404823.1.40735 WP_003404823.1.40799 WP_003404823.1.40852 WP_003404823.1.40876 WP_003404823.1.40881 WP_003404823.1.40922 WP_003404823.1.40948 WP_003404823.1.4095 WP_003404823.1.40956 WP_003404823.1.40957 WP_003404823.1.40964 WP_003404823.1.4097 WP_003404823.1.410 WP_003404823.1.41000 WP_003404823.1.41055 WP_003404823.1.41108 WP_003404823.1.41123 WP_003404823.1.41177 WP_003404823.1.41202 WP_003404823.1.41219 WP_003404823.1.41231 WP_003404823.1.41249 WP_003404823.1.4127 WP_003404823.1.41296 WP_003404823.1.41355 WP_003404823.1.41376 WP_003404823.1.41430 WP_003404823.1.41447 WP_003404823.1.41469 WP_003404823.1.41504 WP_003404823.1.41553 WP_003404823.1.41564 WP_003404823.1.41583 WP_003404823.1.41616 WP_003404823.1.41632 WP_003404823.1.41635 WP_003404823.1.41636 WP_003404823.1.41648 WP_003404823.1.41660 WP_003404823.1.41685 WP_003404823.1.41695 WP_003404823.1.41704 WP_003404823.1.4171 WP_003404823.1.41719 WP_003404823.1.41733 WP_003404823.1.41744 WP_003404823.1.41774 WP_003404823.1.41791 WP_003404823.1.41803 WP_003404823.1.41820 WP_003404823.1.41828 WP_003404823.1.41829 WP_003404823.1.41860 WP_003404823.1.41912 WP_003404823.1.41921 WP_003404823.1.41933 WP_003404823.1.41944 WP_003404823.1.42043 WP_003404823.1.42075 WP_003404823.1.42078 WP_003404823.1.42094 WP_003404823.1.42112 WP_003404823.1.4212 WP_003404823.1.42122 WP_003404823.1.42134 WP_003404823.1.42183 WP_003404823.1.42188 WP_003404823.1.42201 WP_003404823.1.42202 WP_003404823.1.42208 WP_003404823.1.42247 WP_003404823.1.42255 WP_003404823.1.42273 WP_003404823.1.42278 WP_003404823.1.42304 WP_003404823.1.42309 WP_003404823.1.42370 WP_003404823.1.42385 WP_003404823.1.42400 WP_003404823.1.42409 WP_003404823.1.42414 WP_003404823.1.42417 WP_003404823.1.42430 WP_003404823.1.42461 WP_003404823.1.42465 WP_003404823.1.42467 WP_003404823.1.42473 WP_003404823.1.42474 WP_003404823.1.4248 WP_003404823.1.42494 WP_003404823.1.42519 WP_003404823.1.42524 WP_003404823.1.42534 WP_003404823.1.4255 WP_003404823.1.42562 WP_003404823.1.42568 WP_003404823.1.42570 WP_003404823.1.42618 WP_003404823.1.42660 WP_003404823.1.42695 WP_003404823.1.42704 WP_003404823.1.42705 WP_003404823.1.42722 WP_003404823.1.42777 WP_003404823.1.42782 WP_003404823.1.42835 WP_003404823.1.42839 WP_003404823.1.42842 WP_003404823.1.42905 WP_003404823.1.42916 WP_003404823.1.42930 WP_003404823.1.42971 WP_003404823.1.43005 WP_003404823.1.43009 WP_003404823.1.43053 WP_003404823.1.43082 WP_003404823.1.43087 WP_003404823.1.43098 WP_003404823.1.43208 WP_003404823.1.43236 WP_003404823.1.43255 WP_003404823.1.43266 WP_003404823.1.43269 WP_003404823.1.43273 WP_003404823.1.43296 WP_003404823.1.43306 WP_003404823.1.43368 WP_003404823.1.43395 WP_003404823.1.43457 WP_003404823.1.43475 WP_003404823.1.43478 WP_003404823.1.43484 WP_003404823.1.43557 WP_003404823.1.43578 WP_003404823.1.43588 WP_003404823.1.43643 WP_003404823.1.43664 WP_003404823.1.43684 WP_003404823.1.43686 WP_003404823.1.43706 WP_003404823.1.43716 WP_003404823.1.4377 WP_003404823.1.43781 WP_003404823.1.43815 WP_003404823.1.43846 WP_003404823.1.43861 WP_003404823.1.43863 WP_003404823.1.43866 WP_003404823.1.43872 WP_003404823.1.43885 WP_003404823.1.43897 WP_003404823.1.4390 WP_003404823.1.43902 WP_003404823.1.43921 WP_003404823.1.43936 WP_003404823.1.43937 WP_003404823.1.43960 WP_003404823.1.43965 WP_003404823.1.4399 WP_003404823.1.43993 WP_003404823.1.43996 WP_003404823.1.44 WP_003404823.1.44001 WP_003404823.1.44008 WP_003404823.1.44016 WP_003404823.1.44033 WP_003404823.1.44037 WP_003404823.1.44041 WP_003404823.1.44070 WP_003404823.1.44071 WP_003404823.1.44076 WP_003404823.1.44104 WP_003404823.1.44111 WP_003404823.1.44124 WP_003404823.1.44169 WP_003404823.1.44219 WP_003404823.1.44237 WP_003404823.1.44277 WP_003404823.1.44279 WP_003404823.1.44336 WP_003404823.1.44355 WP_003404823.1.44358 WP_003404823.1.4438 WP_003404823.1.44392 WP_003404823.1.4441 WP_003404823.1.44415 WP_003404823.1.44464 WP_003404823.1.44466 WP_003404823.1.44489 WP_003404823.1.44492 WP_003404823.1.44494 WP_003404823.1.44500 WP_003404823.1.44519 WP_003404823.1.44526 WP_003404823.1.44532 WP_003404823.1.44534 WP_003404823.1.44562 WP_003404823.1.44589 WP_003404823.1.44597 WP_003404823.1.44600 WP_003404823.1.44602 WP_003404823.1.44615 WP_003404823.1.4464 WP_003404823.1.44651 WP_003404823.1.44659 WP_003404823.1.44665 WP_003404823.1.44694 WP_003404823.1.44700 WP_003404823.1.44713 WP_003404823.1.44735 WP_003404823.1.44740 WP_003404823.1.44757 WP_003404823.1.4476 WP_003404823.1.44761 WP_003404823.1.44767 WP_003404823.1.44776 WP_003404823.1.44779 WP_003404823.1.44786 WP_003404823.1.44808 WP_003404823.1.44864 WP_003404823.1.44901 WP_003404823.1.44908 WP_003404823.1.44913 WP_003404823.1.4492 WP_003404823.1.44939 WP_003404823.1.44979 WP_003404823.1.44981 WP_003404823.1.45002 WP_003404823.1.45011 WP_003404823.1.4504 WP_003404823.1.45066 WP_003404823.1.45081 WP_003404823.1.45113 WP_003404823.1.45129 WP_003404823.1.45135 WP_003404823.1.45147 WP_003404823.1.45168 WP_003404823.1.4517 WP_003404823.1.45181 WP_003404823.1.45185 WP_003404823.1.45200 WP_003404823.1.45205 WP_003404823.1.45211 WP_003404823.1.45249 WP_003404823.1.4526 WP_003404823.1.45286 WP_003404823.1.45326 WP_003404823.1.45347 WP_003404823.1.45374 WP_003404823.1.45390 WP_003404823.1.454 WP_003404823.1.45407 WP_003404823.1.45451 WP_003404823.1.45453 WP_003404823.1.45460 WP_003404823.1.45463 WP_003404823.1.45470 WP_003404823.1.45474 WP_003404823.1.45491 WP_003404823.1.45510 WP_003404823.1.45563 WP_003404823.1.45584 WP_003404823.1.45590 WP_003404823.1.45619 WP_003404823.1.45626 WP_003404823.1.45631 WP_003404823.1.45666 WP_003404823.1.45697 WP_003404823.1.4571 WP_003404823.1.45731 WP_003404823.1.45743 WP_003404823.1.45765 WP_003404823.1.45776 WP_003404823.1.45783 WP_003404823.1.45805 WP_003404823.1.45815 WP_003404823.1.45849 WP_003404823.1.4590 WP_003404823.1.45923 WP_003404823.1.45926 WP_003404823.1.45963 WP_003404823.1.45989 WP_003404823.1.45992 WP_003404823.1.46025 WP_003404823.1.46083 WP_003404823.1.46092 WP_003404823.1.46100 WP_003404823.1.46101 WP_003404823.1.46103 WP_003404823.1.46107 WP_003404823.1.46127 WP_003404823.1.46128 WP_003404823.1.46129 WP_003404823.1.46141 WP_003404823.1.46150 WP_003404823.1.46201 WP_003404823.1.46226 WP_003404823.1.4624 WP_003404823.1.46253 WP_003404823.1.46268 WP_003404823.1.46285 WP_003404823.1.46313 WP_003404823.1.46336 WP_003404823.1.46365 WP_003404823.1.46370 WP_003404823.1.46381 WP_003404823.1.46402 WP_003404823.1.46411 WP_003404823.1.4644 WP_003404823.1.46442 WP_003404823.1.46453 WP_003404823.1.46463 WP_003404823.1.46478 WP_003404823.1.46492 WP_003404823.1.46521 WP_003404823.1.4653 WP_003404823.1.46532 WP_003404823.1.46539 WP_003404823.1.46568 WP_003404823.1.46585 WP_003404823.1.46609 WP_003404823.1.46613 WP_003404823.1.46625 WP_003404823.1.46642 WP_003404823.1.46647 WP_003404823.1.46674 WP_003404823.1.46724 WP_003404823.1.46758 WP_003404823.1.46773 WP_003404823.1.46777 WP_003404823.1.46786 WP_003404823.1.46792 WP_003404823.1.46847 WP_003404823.1.46851 WP_003404823.1.4687 WP_003404823.1.46897 WP_003404823.1.46936 WP_003404823.1.46980 WP_003404823.1.47011 WP_003404823.1.47012 WP_003404823.1.47066 WP_003404823.1.47077 WP_003404823.1.47083 WP_003404823.1.47106 WP_003404823.1.47142 WP_003404823.1.47147 WP_003404823.1.47166 WP_003404823.1.47178 WP_003404823.1.47179 WP_003404823.1.47194 WP_003404823.1.47207 WP_003404823.1.47210 WP_003404823.1.47261 WP_003404823.1.47262 WP_003404823.1.47402 WP_003404823.1.47423 WP_003404823.1.47467 WP_003404823.1.47502 WP_003404823.1.4751 WP_003404823.1.47511 WP_003404823.1.47537 WP_003404823.1.47540 WP_003404823.1.47568 WP_003404823.1.47572 WP_003404823.1.47636 WP_003404823.1.4764 WP_003404823.1.47679 WP_003404823.1.47681 WP_003404823.1.47690 WP_003404823.1.4771 WP_003404823.1.47717 WP_003404823.1.47743 WP_003404823.1.47754 WP_003404823.1.47773 WP_003404823.1.47776 WP_003404823.1.47780 WP_003404823.1.47805 WP_003404823.1.47832 WP_003404823.1.47847 WP_003404823.1.47858 WP_003404823.1.47861 WP_003404823.1.47868 WP_003404823.1.47893 WP_003404823.1.47899 WP_003404823.1.479 WP_003404823.1.47912 WP_003404823.1.47913 WP_003404823.1.47926 WP_003404823.1.4794 WP_003404823.1.47943 WP_003404823.1.47944 WP_003404823.1.47959 WP_003404823.1.47974 WP_003404823.1.47993 WP_003404823.1.48004 WP_003404823.1.48039 WP_003404823.1.48050 WP_003404823.1.48084 WP_003404823.1.48097 WP_003404823.1.48101 WP_003404823.1.48109 WP_003404823.1.48130 WP_003404823.1.48135 WP_003404823.1.48143 WP_003404823.1.48152 WP_003404823.1.48155 WP_003404823.1.48170 WP_003404823.1.48173 WP_003404823.1.48177 WP_003404823.1.48185 WP_003404823.1.48204 WP_003404823.1.48219 WP_003404823.1.4823 WP_003404823.1.48240 WP_003404823.1.48256 WP_003404823.1.48264 WP_003404823.1.48287 WP_003404823.1.48330 WP_003404823.1.48333 WP_003404823.1.48348 WP_003404823.1.48354 WP_003404823.1.48372 WP_003404823.1.48383 WP_003404823.1.48388 WP_003404823.1.48419 WP_003404823.1.48423 WP_003404823.1.48443 WP_003404823.1.48450 WP_003404823.1.48462 WP_003404823.1.48543 WP_003404823.1.48550 WP_003404823.1.48605 WP_003404823.1.48618 WP_003404823.1.4863 WP_003404823.1.48648 WP_003404823.1.48658 WP_003404823.1.48666 WP_003404823.1.48687 WP_003404823.1.48779 WP_003404823.1.4878 WP_003404823.1.48798 WP_003404823.1.48802 WP_003404823.1.48826 WP_003404823.1.48831 WP_003404823.1.48843 WP_003404823.1.48857 WP_003404823.1.4890 WP_003404823.1.48946 WP_003404823.1.48979 WP_003404823.1.49017 WP_003404823.1.49048 WP_003404823.1.49059 WP_003404823.1.4906 WP_003404823.1.4907 WP_003404823.1.49103 WP_003404823.1.49110 WP_003404823.1.49111 WP_003404823.1.49112 WP_003404823.1.4919 WP_003404823.1.49251 WP_003404823.1.49254 WP_003404823.1.49263 WP_003404823.1.49291 WP_003404823.1.49296 WP_003404823.1.49335 WP_003404823.1.49337 WP_003404823.1.49419 WP_003404823.1.49426 WP_003404823.1.49437 WP_003404823.1.49439 WP_003404823.1.49474 WP_003404823.1.49506 WP_003404823.1.49516 WP_003404823.1.49523 WP_003404823.1.49526 WP_003404823.1.49532 WP_003404823.1.49588 WP_003404823.1.4959 WP_003404823.1.49678 WP_003404823.1.49687 WP_003404823.1.49699 WP_003404823.1.49709 WP_003404823.1.4971 WP_003404823.1.4972 WP_003404823.1.49736 WP_003404823.1.49746 WP_003404823.1.49764 WP_003404823.1.49773 WP_003404823.1.49796 WP_003404823.1.49814 WP_003404823.1.49815 WP_003404823.1.49816 WP_003404823.1.49839 WP_003404823.1.49857 WP_003404823.1.49878 WP_003404823.1.49880 WP_003404823.1.49944 WP_003404823.1.4999 WP_003404823.1.49990 WP_003404823.1.50068 WP_003404823.1.50077 WP_003404823.1.5008 WP_003404823.1.50081 WP_003404823.1.50122 WP_003404823.1.50126 WP_003404823.1.50149 WP_003404823.1.50162 WP_003404823.1.5018 WP_003404823.1.50194 WP_003404823.1.50218 WP_003404823.1.50235 WP_003404823.1.50249 WP_003404823.1.50265 WP_003404823.1.50271 WP_003404823.1.50324 WP_003404823.1.50347 WP_003404823.1.50372 WP_003404823.1.50398 WP_003404823.1.50407 WP_003404823.1.50444 WP_003404823.1.50466 WP_003404823.1.50472 WP_003404823.1.5048 WP_003404823.1.50498 WP_003404823.1.5050 WP_003404823.1.50540 WP_003404823.1.50554 WP_003404823.1.50557 WP_003404823.1.50601 WP_003404823.1.50610 WP_003404823.1.50632 WP_003404823.1.50633 WP_003404823.1.50642 WP_003404823.1.50655 WP_003404823.1.50659 WP_003404823.1.50683 WP_003404823.1.50689 WP_003404823.1.50692 WP_003404823.1.50714 WP_003404823.1.50729 WP_003404823.1.50756 WP_003404823.1.50784 WP_003404823.1.50794 WP_003404823.1.50841 WP_003404823.1.50860 WP_003404823.1.50868 WP_003404823.1.50877 WP_003404823.1.5096 WP_003404823.1.50981 WP_003404823.1.50987 WP_003404823.1.51003 WP_003404823.1.51009 WP_003404823.1.51037 WP_003404823.1.51074 WP_003404823.1.51082 WP_003404823.1.51101 WP_003404823.1.51116 WP_003404823.1.51149 WP_003404823.1.51156 WP_003404823.1.51157 WP_003404823.1.51213 WP_003404823.1.51232 WP_003404823.1.51239 WP_003404823.1.51247 WP_003404823.1.51266 WP_003404823.1.51279 WP_003404823.1.51291 WP_003404823.1.51294 WP_003404823.1.51301 WP_003404823.1.51329 WP_003404823.1.51391 WP_003404823.1.51422 WP_003404823.1.51445 WP_003404823.1.51455 WP_003404823.1.51466 WP_003404823.1.51468 WP_003404823.1.51478 WP_003404823.1.51497 WP_003404823.1.51520 WP_003404823.1.51593 WP_003404823.1.51628 WP_003404823.1.5164 WP_003404823.1.51647 WP_003404823.1.51660 WP_003404823.1.51696 WP_003404823.1.51721 WP_003404823.1.51788 WP_003404823.1.51795 WP_003404823.1.51801 WP_003404823.1.51817 WP_003404823.1.51819 WP_003404823.1.51854 WP_003404823.1.51923 WP_003404823.1.51942 WP_003404823.1.51948 WP_003404823.1.51963 WP_003404823.1.51969 WP_003404823.1.52000 WP_003404823.1.52001 WP_003404823.1.52003 WP_003404823.1.52006 WP_003404823.1.52036 WP_003404823.1.52038 WP_003404823.1.52046 WP_003404823.1.52059 WP_003404823.1.52069 WP_003404823.1.52082 WP_003404823.1.52102 WP_003404823.1.52106 WP_003404823.1.52166 WP_003404823.1.52168 WP_003404823.1.52173 WP_003404823.1.52178 WP_003404823.1.52206 WP_003404823.1.52216 WP_003404823.1.52238 WP_003404823.1.52241 WP_003404823.1.52280 WP_003404823.1.52314 WP_003404823.1.52385 WP_003404823.1.52390 WP_003404823.1.524 WP_003404823.1.52460 WP_003404823.1.52485 WP_003404823.1.52486 WP_003404823.1.52495 WP_003404823.1.52504 WP_003404823.1.52522 WP_003404823.1.52531 WP_003404823.1.52533 WP_003404823.1.52545 WP_003404823.1.52553 WP_003404823.1.52563 WP_003404823.1.52564 WP_003404823.1.52574 WP_003404823.1.52641 WP_003404823.1.52673 WP_003404823.1.52674 WP_003404823.1.52708 WP_003404823.1.52713 WP_003404823.1.52761 WP_003404823.1.52778 WP_003404823.1.52791 WP_003404823.1.52797 WP_003404823.1.52818 WP_003404823.1.52872 WP_003404823.1.52873 WP_003404823.1.52891 WP_003404823.1.52892 WP_003404823.1.52909 WP_003404823.1.52970 WP_003404823.1.52998 WP_003404823.1.53053 WP_003404823.1.53056 WP_003404823.1.5306 WP_003404823.1.53088 WP_003404823.1.5309 WP_003404823.1.531 WP_003404823.1.53117 WP_003404823.1.53118 WP_003404823.1.53142 WP_003404823.1.53143 WP_003404823.1.53157 WP_003404823.1.53167 WP_003404823.1.53200 WP_003404823.1.53204 WP_003404823.1.53213 WP_003404823.1.53217 WP_003404823.1.53226 WP_003404823.1.53229 WP_003404823.1.53230 WP_003404823.1.53237 WP_003404823.1.53254 WP_003404823.1.53257 WP_003404823.1.5327 WP_003404823.1.53276 WP_003404823.1.53278 WP_003404823.1.533 WP_003404823.1.53302 WP_003404823.1.53306 WP_003404823.1.5334 WP_003404823.1.5335 WP_003404823.1.53353 WP_003404823.1.53381 WP_003404823.1.53413 WP_003404823.1.53458 WP_003404823.1.53460 WP_003404823.1.53480 WP_003404823.1.53517 WP_003404823.1.53522 WP_003404823.1.53526 WP_003404823.1.53553 WP_003404823.1.53606 WP_003404823.1.53609 WP_003404823.1.53628 WP_003404823.1.53643 WP_003404823.1.53667 WP_003404823.1.53679 WP_003404823.1.53715 WP_003404823.1.53730 WP_003404823.1.53742 WP_003404823.1.53743 WP_003404823.1.53754 WP_003404823.1.53775 WP_003404823.1.53787 WP_003404823.1.53803 WP_003404823.1.53818 WP_003404823.1.53822 WP_003404823.1.53853 WP_003404823.1.53888 WP_003404823.1.53900 WP_003404823.1.53912 WP_003404823.1.53914 WP_003404823.1.53952 WP_003404823.1.5398 WP_003404823.1.5408 WP_003404823.1.54089 WP_003404823.1.54093 WP_003404823.1.54099 WP_003404823.1.54112 WP_003404823.1.54125 WP_003404823.1.54141 WP_003404823.1.54162 WP_003404823.1.54179 WP_003404823.1.54206 WP_003404823.1.54218 WP_003404823.1.54225 WP_003404823.1.54227 WP_003404823.1.54232 WP_003404823.1.54241 WP_003404823.1.54245 WP_003404823.1.54247 WP_003404823.1.54260 WP_003404823.1.54275 WP_003404823.1.54280 WP_003404823.1.5429 WP_003404823.1.54294 WP_003404823.1.54314 WP_003404823.1.54347 WP_003404823.1.54351 WP_003404823.1.54370 WP_003404823.1.54428 WP_003404823.1.54449 WP_003404823.1.54494 WP_003404823.1.54502 WP_003404823.1.54514 WP_003404823.1.54519 WP_003404823.1.5452 WP_003404823.1.54531 WP_003404823.1.54537 WP_003404823.1.54553 WP_003404823.1.54555 WP_003404823.1.54575 WP_003404823.1.54633 WP_003404823.1.54686 WP_003404823.1.54687 WP_003404823.1.54705 WP_003404823.1.54730 WP_003404823.1.54732 WP_003404823.1.5475 WP_003404823.1.54797 WP_003404823.1.54807 WP_003404823.1.54836 WP_003404823.1.54838 WP_003404823.1.54860 WP_003404823.1.54888 WP_003404823.1.54897 WP_003404823.1.54905 WP_003404823.1.54909 WP_003404823.1.54937 WP_003404823.1.54939 WP_003404823.1.54944 WP_003404823.1.54945 WP_003404823.1.54953 WP_003404823.1.54964 WP_003404823.1.55015 WP_003404823.1.55022 WP_003404823.1.55023 WP_003404823.1.55051 WP_003404823.1.55072 WP_003404823.1.55088 WP_003404823.1.55106 WP_003404823.1.55126 WP_003404823.1.55128 WP_003404823.1.55140 WP_003404823.1.55150 WP_003404823.1.55210 WP_003404823.1.55227 WP_003404823.1.55248 WP_003404823.1.55257 WP_003404823.1.55258 WP_003404823.1.55267 WP_003404823.1.55279 WP_003404823.1.55307 WP_003404823.1.55326 WP_003404823.1.55328 WP_003404823.1.5533 WP_003404823.1.55345 WP_003404823.1.55396 WP_003404823.1.55398 WP_003404823.1.55441 WP_003404823.1.55459 WP_003404823.1.55501 WP_003404823.1.55504 WP_003404823.1.55578 WP_003404823.1.55626 WP_003404823.1.55641 WP_003404823.1.5569 WP_003404823.1.55723 WP_003404823.1.55735 WP_003404823.1.5574 WP_003404823.1.55772 WP_003404823.1.55802 WP_003404823.1.55807 WP_003404823.1.55819 WP_003404823.1.55821 WP_003404823.1.5583 WP_003404823.1.55849 WP_003404823.1.55856 WP_003404823.1.55860 WP_003404823.1.55882 WP_003404823.1.55883 WP_003404823.1.55894 WP_003404823.1.55902 WP_003404823.1.55908 WP_003404823.1.55909 WP_003404823.1.5591 WP_003404823.1.55961 WP_003404823.1.55977 WP_003404823.1.55983 WP_003404823.1.56028 WP_003404823.1.56057 WP_003404823.1.56060 WP_003404823.1.56107 WP_003404823.1.56132 WP_003404823.1.56163 WP_003404823.1.56167 WP_003404823.1.56178 WP_003404823.1.56287 WP_003404823.1.56292 WP_003404823.1.56327 WP_003404823.1.56341 WP_003404823.1.56359 WP_003404823.1.56365 WP_003404823.1.56394 WP_003404823.1.56443 WP_003404823.1.56478 WP_003404823.1.56500 WP_003404823.1.56517 WP_003404823.1.56534 WP_003404823.1.5656 WP_003404823.1.56577 WP_003404823.1.56625 WP_003404823.1.56637 WP_003404823.1.56670 WP_003404823.1.56697 WP_003404823.1.567 WP_003404823.1.56701 WP_003404823.1.56709 WP_003404823.1.56729 WP_003404823.1.56743 WP_003404823.1.56755 WP_003404823.1.56764 WP_003404823.1.56769 WP_003404823.1.56770 WP_003404823.1.56795 WP_003404823.1.56827 WP_003404823.1.56839 WP_003404823.1.56863 WP_003404823.1.56868 WP_003404823.1.56869 WP_003404823.1.56915 WP_003404823.1.56926 WP_003404823.1.56961 WP_003404823.1.56971 WP_003404823.1.56972 WP_003404823.1.57023 WP_003404823.1.57035 WP_003404823.1.57077 WP_003404823.1.57087 WP_003404823.1.57094 WP_003404823.1.57134 WP_003404823.1.57151 WP_003404823.1.57169 WP_003404823.1.57208 WP_003404823.1.57212 WP_003404823.1.5724 WP_003404823.1.5725 WP_003404823.1.5727 WP_003404823.1.57273 WP_003404823.1.573 WP_003404823.1.57326 WP_003404823.1.57328 WP_003404823.1.57331 WP_003404823.1.57340 WP_003404823.1.57351 WP_003404823.1.57352 WP_003404823.1.57380 WP_003404823.1.57430 WP_003404823.1.5744 WP_003404823.1.57440 WP_003404823.1.5745 WP_003404823.1.57461 WP_003404823.1.57469 WP_003404823.1.57489 WP_003404823.1.575 WP_003404823.1.57509 WP_003404823.1.57519 WP_003404823.1.57525 WP_003404823.1.57551 WP_003404823.1.5758 WP_003404823.1.57596 WP_003404823.1.57604 WP_003404823.1.57616 WP_003404823.1.57617 WP_003404823.1.57619 WP_003404823.1.57627 WP_003404823.1.57642 WP_003404823.1.57667 WP_003404823.1.57675 WP_003404823.1.57708 WP_003404823.1.57794 WP_003404823.1.57821 WP_003404823.1.57825 WP_003404823.1.57843 WP_003404823.1.57906 WP_003404823.1.57924 WP_003404823.1.57926 WP_003404823.1.57930 WP_003404823.1.57957 WP_003404823.1.57960 WP_003404823.1.57964 WP_003404823.1.57991 WP_003404823.1.58000 WP_003404823.1.58086 WP_003404823.1.58101 WP_003404823.1.58103 WP_003404823.1.58108 WP_003404823.1.5811 WP_003404823.1.58121 WP_003404823.1.58145 WP_003404823.1.58164 WP_003404823.1.58174 WP_003404823.1.582 WP_003404823.1.58202 WP_003404823.1.58209 WP_003404823.1.58215 WP_003404823.1.5824 WP_003404823.1.58250 WP_003404823.1.58259 WP_003404823.1.58283 WP_003404823.1.58288 WP_003404823.1.5830 WP_003404823.1.58303 WP_003404823.1.58311 WP_003404823.1.58330 WP_003404823.1.58359 WP_003404823.1.58386 WP_003404823.1.58393 WP_003404823.1.58431 WP_003404823.1.5844 WP_003404823.1.58457 WP_003404823.1.58488 WP_003404823.1.58518 WP_003404823.1.58534 WP_003404823.1.58559 WP_003404823.1.58567 WP_003404823.1.58573 WP_003404823.1.58602 WP_003404823.1.58612 WP_003404823.1.58619 WP_003404823.1.58630 WP_003404823.1.5865 WP_003404823.1.58671 WP_003404823.1.58690 WP_003404823.1.58702 WP_003404823.1.58743 WP_003404823.1.58754 WP_003404823.1.5879 WP_003404823.1.5881 WP_003404823.1.58824 WP_003404823.1.58848 WP_003404823.1.58857 WP_003404823.1.58891 WP_003404823.1.58892 WP_003404823.1.5890 WP_003404823.1.58904 WP_003404823.1.58921 WP_003404823.1.58930 WP_003404823.1.58939 WP_003404823.1.58941 WP_003404823.1.58953 WP_003404823.1.58961 WP_003404823.1.5898 WP_003404823.1.59025 WP_003404823.1.59029 WP_003404823.1.59037 WP_003404823.1.59044 WP_003404823.1.59088 WP_003404823.1.59112 WP_003404823.1.59130 WP_003404823.1.5914 WP_003404823.1.59147 WP_003404823.1.59166 WP_003404823.1.59205 WP_003404823.1.59209 WP_003404823.1.59237 WP_003404823.1.59240 WP_003404823.1.59253 WP_003404823.1.59254 WP_003404823.1.59262 WP_003404823.1.59270 WP_003404823.1.5928 WP_003404823.1.59304 WP_003404823.1.59305 WP_003404823.1.59309 WP_003404823.1.59316 WP_003404823.1.59326 WP_003404823.1.59328 WP_003404823.1.59333 WP_003404823.1.59338 WP_003404823.1.59388 WP_003404823.1.59428 WP_003404823.1.59487 WP_003404823.1.59537 WP_003404823.1.59561 WP_003404823.1.59677 WP_003404823.1.59722 WP_003404823.1.59732 WP_003404823.1.59738 WP_003404823.1.59750 WP_003404823.1.59761 WP_003404823.1.59808 WP_003404823.1.59850 WP_003404823.1.59860 WP_003404823.1.59861 WP_003404823.1.5987 WP_003404823.1.59878 WP_003404823.1.59888 WP_003404823.1.59952 WP_003404823.1.5996 WP_003404823.1.59961 WP_003404823.1.59974 WP_003404823.1.6000 WP_003404823.1.60007 WP_003404823.1.60016 WP_003404823.1.6003 WP_003404823.1.60047 WP_003404823.1.6007 WP_003404823.1.60121 WP_003404823.1.60125 WP_003404823.1.60135 WP_003404823.1.60139 WP_003404823.1.60152 WP_003404823.1.60171 WP_003404823.1.60197 WP_003404823.1.6020 WP_003404823.1.60205 WP_003404823.1.60207 WP_003404823.1.60215 WP_003404823.1.60217 WP_003404823.1.60267 WP_003404823.1.60288 WP_003404823.1.60301 WP_003404823.1.60305 WP_003404823.1.60312 WP_003404823.1.60313 WP_003404823.1.60314 WP_003404823.1.60367 WP_003404823.1.60376 WP_003404823.1.60403 WP_003404823.1.60413 WP_003404823.1.60421 WP_003404823.1.60451 WP_003404823.1.60460 WP_003404823.1.60479 WP_003404823.1.60487 WP_003404823.1.60512 WP_003404823.1.60573 WP_003404823.1.60583 WP_003404823.1.60632 WP_003404823.1.60657 WP_003404823.1.60687 WP_003404823.1.60689 WP_003404823.1.60727 WP_003404823.1.60738 WP_003404823.1.60763 WP_003404823.1.6077 WP_003404823.1.60791 WP_003404823.1.60834 WP_003404823.1.60870 WP_003404823.1.60878 WP_003404823.1.60879 WP_003404823.1.60913 WP_003404823.1.60978 WP_003404823.1.61000 WP_003404823.1.61001 WP_003404823.1.61012 WP_003404823.1.61014 WP_003404823.1.61015 WP_003404823.1.61037 WP_003404823.1.61052 WP_003404823.1.61065 WP_003404823.1.61100 WP_003404823.1.61101 WP_003404823.1.61138 WP_003404823.1.61142 WP_003404823.1.61198 WP_003404823.1.612 WP_003404823.1.61234 WP_003404823.1.61256 WP_003404823.1.61281 WP_003404823.1.61314 WP_003404823.1.61321 WP_003404823.1.61326 WP_003404823.1.61328 WP_003404823.1.61368 WP_003404823.1.61391 WP_003404823.1.61406 WP_003404823.1.61409 WP_003404823.1.61420 WP_003404823.1.61422 WP_003404823.1.61425 WP_003404823.1.61428 WP_003404823.1.61469 WP_003404823.1.61494 WP_003404823.1.61522 WP_003404823.1.61552 WP_003404823.1.61557 WP_003404823.1.61567 WP_003404823.1.61571 WP_003404823.1.61573 WP_003404823.1.61584 WP_003404823.1.61586 WP_003404823.1.6159 WP_003404823.1.61592 WP_003404823.1.6160 WP_003404823.1.61614 WP_003404823.1.6163 WP_003404823.1.61655 WP_003404823.1.61665 WP_003404823.1.61669 WP_003404823.1.61682 WP_003404823.1.61692 WP_003404823.1.61719 WP_003404823.1.61728 WP_003404823.1.61750 WP_003404823.1.61754 WP_003404823.1.61755 WP_003404823.1.61757 WP_003404823.1.61778 WP_003404823.1.6179 WP_003404823.1.61793 WP_003404823.1.61816 WP_003404823.1.61842 WP_003404823.1.61850 WP_003404823.1.61862 WP_003404823.1.61865 WP_003404823.1.61868 WP_003404823.1.61911 WP_003404823.1.61925 WP_003404823.1.61941 WP_003404823.1.61953 WP_003404823.1.61979 WP_003404823.1.61986 WP_003404823.1.61987 WP_003404823.1.61998 WP_003404823.1.62021 WP_003404823.1.62087 WP_003404823.1.62089 WP_003404823.1.62101 WP_003404823.1.62104 WP_003404823.1.6211 WP_003404823.1.62132 WP_003404823.1.62162 WP_003404823.1.62225 WP_003404823.1.62230 WP_003404823.1.62238 WP_003404823.1.62249 WP_003404823.1.62270 WP_003404823.1.62281 WP_003404823.1.62307 WP_003404823.1.6231 WP_003404823.1.62359 WP_003404823.1.62360 WP_003404823.1.62371 WP_003404823.1.62379 WP_003404823.1.62395 WP_003404823.1.62408 WP_003404823.1.62449 WP_003404823.1.62468 WP_003404823.1.6248 WP_003404823.1.62508 WP_003404823.1.62565 WP_003404823.1.62594 WP_003404823.1.62606 WP_003404823.1.62616 WP_003404823.1.62666 WP_003404823.1.62687 WP_003404823.1.62715 WP_003404823.1.62730 WP_003404823.1.62738 WP_003404823.1.62761 WP_003404823.1.62766 WP_003404823.1.62786 WP_003404823.1.62813 WP_003404823.1.62839 WP_003404823.1.62841 WP_003404823.1.62936 WP_003404823.1.6294 WP_003404823.1.6295 WP_003404823.1.62962 WP_003404823.1.63007 WP_003404823.1.63019 WP_003404823.1.63032 WP_003404823.1.63037 WP_003404823.1.63064 WP_003404823.1.63066 WP_003404823.1.63072 WP_003404823.1.6308 WP_003404823.1.63081 WP_003404823.1.63096 WP_003404823.1.63106 WP_003404823.1.6314 WP_003404823.1.63144 WP_003404823.1.63154 WP_003404823.1.63160 WP_003404823.1.63161 WP_003404823.1.63166 WP_003404823.1.63175 WP_003404823.1.63194 WP_003404823.1.6322 WP_003404823.1.63222 WP_003404823.1.63247 WP_003404823.1.6328 WP_003404823.1.63291 WP_003404823.1.63317 WP_003404823.1.63331 WP_003404823.1.63373 WP_003404823.1.63384 WP_003404823.1.63403 WP_003404823.1.63424 WP_003404823.1.63428 WP_003404823.1.6345 WP_003404823.1.63464 WP_003404823.1.63483 WP_003404823.1.63502 WP_003404823.1.63504 WP_003404823.1.63522 WP_003404823.1.63530 WP_003404823.1.63538 WP_003404823.1.63564 WP_003404823.1.63567 WP_003404823.1.63596 WP_003404823.1.63600 WP_003404823.1.63623 WP_003404823.1.63625 WP_003404823.1.63627 WP_003404823.1.63654 WP_003404823.1.63662 WP_003404823.1.63711 WP_003404823.1.63734 WP_003404823.1.63807 WP_003404823.1.63819 WP_003404823.1.63844 WP_003404823.1.63888 WP_003404823.1.63913 WP_003404823.1.63915 WP_003404823.1.63918 WP_003404823.1.63970 WP_003404823.1.64000 WP_003404823.1.64027 WP_003404823.1.64058 WP_003404823.1.64065 WP_003404823.1.6407 WP_003404823.1.64082 WP_003404823.1.64091 WP_003404823.1.64102 WP_003404823.1.64104 WP_003404823.1.64119 WP_003404823.1.64169 WP_003404823.1.64219 WP_003404823.1.6422 WP_003404823.1.64222 WP_003404823.1.64223 WP_003404823.1.64228 WP_003404823.1.64235 WP_003404823.1.64249 WP_003404823.1.6427 WP_003404823.1.64278 WP_003404823.1.64287 WP_003404823.1.64414 WP_003404823.1.64419 WP_003404823.1.6443 WP_003404823.1.64463 WP_003404823.1.64480 WP_003404823.1.64497 WP_003404823.1.64506 WP_003404823.1.64511 WP_003404823.1.64513 WP_003404823.1.64514 WP_003404823.1.64515 WP_003404823.1.64522 WP_003404823.1.64526 WP_003404823.1.64543 WP_003404823.1.6456 WP_003404823.1.64567 WP_003404823.1.64588 WP_003404823.1.64589 WP_003404823.1.64594 WP_003404823.1.64608 WP_003404823.1.64619 WP_003404823.1.64629 WP_003404823.1.6464 WP_003404823.1.64664 WP_003404823.1.64669 WP_003404823.1.64680 WP_003404823.1.64727 WP_003404823.1.64729 WP_003404823.1.64774 WP_003404823.1.64776 WP_003404823.1.64802 WP_003404823.1.64832 WP_003404823.1.6486 WP_003404823.1.64870 WP_003404823.1.64922 WP_003404823.1.64924 WP_003404823.1.6493 WP_003404823.1.64937 WP_003404823.1.64941 WP_003404823.1.64966 WP_003404823.1.65001 WP_003404823.1.65026 WP_003404823.1.65053 WP_003404823.1.65070 WP_003404823.1.65079 WP_003404823.1.65102 WP_003404823.1.65157 WP_003404823.1.65181 WP_003404823.1.65212 WP_003404823.1.65229 WP_003404823.1.6523 WP_003404823.1.65253 WP_003404823.1.65289 WP_003404823.1.65291 WP_003404823.1.65315 WP_003404823.1.65329 WP_003404823.1.65359 WP_003404823.1.6536 WP_003404823.1.65374 WP_003404823.1.65386 WP_003404823.1.65414 WP_003404823.1.65416 WP_003404823.1.65433 WP_003404823.1.65455 WP_003404823.1.65488 WP_003404823.1.65529 WP_003404823.1.65539 WP_003404823.1.65583 WP_003404823.1.65612 WP_003404823.1.65623 WP_003404823.1.65635 WP_003404823.1.65637 WP_003404823.1.65648 WP_003404823.1.65683 WP_003404823.1.65686 WP_003404823.1.65688 WP_003404823.1.65707 WP_003404823.1.65733 WP_003404823.1.65746 WP_003404823.1.65747 WP_003404823.1.65759 WP_003404823.1.65816 WP_003404823.1.65830 WP_003404823.1.65858 WP_003404823.1.65862 WP_003404823.1.65869 WP_003404823.1.65893 WP_003404823.1.65929 WP_003404823.1.65932 WP_003404823.1.65958 WP_003404823.1.65974 WP_003404823.1.66004 WP_003404823.1.66013 WP_003404823.1.6606 WP_003404823.1.66089 WP_003404823.1.66149 WP_003404823.1.66151 WP_003404823.1.66229 WP_003404823.1.66276 WP_003404823.1.66293 WP_003404823.1.66297 WP_003404823.1.66323 WP_003404823.1.66325 WP_003404823.1.6633 WP_003404823.1.66334 WP_003404823.1.66355 WP_003404823.1.66367 WP_003404823.1.66394 WP_003404823.1.66396 WP_003404823.1.66451 WP_003404823.1.66455 WP_003404823.1.66457 WP_003404823.1.66460 WP_003404823.1.66464 WP_003404823.1.66466 WP_003404823.1.66487 WP_003404823.1.66504 WP_003404823.1.66544 WP_003404823.1.66580 WP_003404823.1.66582 WP_003404823.1.66612 WP_003404823.1.66615 WP_003404823.1.66617 WP_003404823.1.66635 WP_003404823.1.66656 WP_003404823.1.66663 WP_003404823.1.66675 WP_003404823.1.66718 WP_003404823.1.66762 WP_003404823.1.66776 WP_003404823.1.66808 WP_003404823.1.66817 WP_003404823.1.66819 WP_003404823.1.66826 WP_003404823.1.66830 WP_003404823.1.66842 WP_003404823.1.66868 WP_003404823.1.66878 WP_003404823.1.66880 WP_003404823.1.66893 WP_003404823.1.66961 WP_003404823.1.67005 WP_003404823.1.6704 WP_003404823.1.67044 WP_003404823.1.67061 WP_003404823.1.67089 WP_003404823.1.67098 WP_003404823.1.67146 WP_003404823.1.67170 WP_003404823.1.67197 WP_003404823.1.67198 WP_003404823.1.6720 WP_003404823.1.67207 WP_003404823.1.67218 WP_003404823.1.67220 WP_003404823.1.67225 WP_003404823.1.67231 WP_003404823.1.6724 WP_003404823.1.67257 WP_003404823.1.67307 WP_003404823.1.67324 WP_003404823.1.67332 WP_003404823.1.67346 WP_003404823.1.67354 WP_003404823.1.67360 WP_003404823.1.67381 WP_003404823.1.67396 WP_003404823.1.67417 WP_003404823.1.67422 WP_003404823.1.67453 WP_003404823.1.67459 WP_003404823.1.6746 WP_003404823.1.67473 WP_003404823.1.67481 WP_003404823.1.67482 WP_003404823.1.67496 WP_003404823.1.67499 WP_003404823.1.67516 WP_003404823.1.67523 WP_003404823.1.67536 WP_003404823.1.67575 WP_003404823.1.67587 WP_003404823.1.67598 WP_003404823.1.67600 WP_003404823.1.67602 WP_003404823.1.67630 WP_003404823.1.67679 WP_003404823.1.67692 WP_003404823.1.67744 WP_003404823.1.6775 WP_003404823.1.67750 WP_003404823.1.6777 WP_003404823.1.67809 WP_003404823.1.67816 WP_003404823.1.67844 WP_003404823.1.67848 WP_003404823.1.67870 WP_003404823.1.67888 WP_003404823.1.67915 WP_003404823.1.67945 WP_003404823.1.67949 WP_003404823.1.67980 WP_003404823.1.67982 WP_003404823.1.68022 WP_003404823.1.68029 WP_003404823.1.68037 WP_003404823.1.68038 WP_003404823.1.68045 WP_003404823.1.68057 WP_003404823.1.68083 WP_003404823.1.68088 WP_003404823.1.68106 WP_003404823.1.68110 WP_003404823.1.68153 WP_003404823.1.68164 WP_003404823.1.68169 WP_003404823.1.68193 WP_003404823.1.68212 WP_003404823.1.68243 WP_003404823.1.6825 WP_003404823.1.68297 WP_003404823.1.68309 WP_003404823.1.68325 WP_003404823.1.68329 WP_003404823.1.68340 WP_003404823.1.68384 WP_003404823.1.68388 WP_003404823.1.68429 WP_003404823.1.6843 WP_003404823.1.68433 WP_003404823.1.68444 WP_003404823.1.68465 WP_003404823.1.68484 WP_003404823.1.68518 WP_003404823.1.68569 WP_003404823.1.68576 WP_003404823.1.68580 WP_003404823.1.68586 WP_003404823.1.68623 WP_003404823.1.68624 WP_003404823.1.68637 WP_003404823.1.68646 WP_003404823.1.68667 WP_003404823.1.68669 WP_003404823.1.68672 WP_003404823.1.68684 WP_003404823.1.68704 WP_003404823.1.68708 WP_003404823.1.6872 WP_003404823.1.68730 WP_003404823.1.68734 WP_003404823.1.68748 WP_003404823.1.68754 WP_003404823.1.6876 WP_003404823.1.68761 WP_003404823.1.68763 WP_003404823.1.68766 WP_003404823.1.68774 WP_003404823.1.68796 WP_003404823.1.68824 WP_003404823.1.68832 WP_003404823.1.68833 WP_003404823.1.68841 WP_003404823.1.68859 WP_003404823.1.68876 WP_003404823.1.68906 WP_003404823.1.68923 WP_003404823.1.68945 WP_003404823.1.6896 WP_003404823.1.68981 WP_003404823.1.68984 WP_003404823.1.68997 WP_003404823.1.69008 WP_003404823.1.69079 WP_003404823.1.6908 WP_003404823.1.69082 WP_003404823.1.69178 WP_003404823.1.69181 WP_003404823.1.69208 WP_003404823.1.69231 WP_003404823.1.69256 WP_003404823.1.69311 WP_003404823.1.69315 WP_003404823.1.69322 WP_003404823.1.69342 WP_003404823.1.6935 WP_003404823.1.6936 WP_003404823.1.69369 WP_003404823.1.69374 WP_003404823.1.69398 WP_003404823.1.69401 WP_003404823.1.69426 WP_003404823.1.69427 WP_003404823.1.69429 WP_003404823.1.6949 WP_003404823.1.6951 WP_003404823.1.69511 WP_003404823.1.69526 WP_003404823.1.69528 WP_003404823.1.69547 WP_003404823.1.69573 WP_003404823.1.69581 WP_003404823.1.6960 WP_003404823.1.69617 WP_003404823.1.69634 WP_003404823.1.69647 WP_003404823.1.69659 WP_003404823.1.69673 WP_003404823.1.69682 WP_003404823.1.69684 WP_003404823.1.69686 WP_003404823.1.69707 WP_003404823.1.69709 WP_003404823.1.69736 WP_003404823.1.69778 WP_003404823.1.69800 WP_003404823.1.69802 WP_003404823.1.69845 WP_003404823.1.69870 WP_003404823.1.69873 WP_003404823.1.69898 WP_003404823.1.69913 WP_003404823.1.69925 WP_003404823.1.69931 WP_003404823.1.69938 WP_003404823.1.69955 WP_003404823.1.69957 WP_003404823.1.69981 WP_003404823.1.69990 WP_003404823.1.70 WP_003404823.1.70000 WP_003404823.1.70017 WP_003404823.1.70032 WP_003404823.1.70055 WP_003404823.1.70062 WP_003404823.1.70072 WP_003404823.1.70131 WP_003404823.1.70132 WP_003404823.1.7022 WP_003404823.1.70227 WP_003404823.1.70255 WP_003404823.1.70271 WP_003404823.1.70274 WP_003404823.1.7029 WP_003404823.1.70325 WP_003404823.1.70328 WP_003404823.1.70356 WP_003404823.1.70364 WP_003404823.1.70368 WP_003404823.1.70369 WP_003404823.1.70422 WP_003404823.1.70435 WP_003404823.1.70444 WP_003404823.1.70463 WP_003404823.1.70471 WP_003404823.1.70480 WP_003404823.1.70494 WP_003404823.1.70498 WP_003404823.1.70505 WP_003404823.1.70525 WP_003404823.1.70573 WP_003404823.1.70577 WP_003404823.1.70610 WP_003404823.1.70618 WP_003404823.1.70622 WP_003404823.1.70626 WP_003404823.1.70668 WP_003404823.1.70699 WP_003404823.1.70704 WP_003404823.1.70729 WP_003404823.1.70757 WP_003404823.1.70782 WP_003404823.1.70834 WP_003404823.1.7084 WP_003404823.1.70840 WP_003404823.1.70864 WP_003404823.1.70871 WP_003404823.1.70915 WP_003404823.1.70958 WP_003404823.1.70964 WP_003404823.1.70976 WP_003404823.1.71015 WP_003404823.1.71026 WP_003404823.1.71063 WP_003404823.1.71076 WP_003404823.1.71083 WP_003404823.1.7111 WP_003404823.1.71118 WP_003404823.1.71128 WP_003404823.1.7113 WP_003404823.1.71187 WP_003404823.1.71191 WP_003404823.1.71255 WP_003404823.1.71258 WP_003404823.1.71259 WP_003404823.1.71289 WP_003404823.1.71326 WP_003404823.1.71329 WP_003404823.1.71331 WP_003404823.1.71344 WP_003404823.1.71390 WP_003404823.1.71414 WP_003404823.1.71440 WP_003404823.1.71457 WP_003404823.1.7146 WP_003404823.1.71464 WP_003404823.1.71490 WP_003404823.1.71509 WP_003404823.1.71516 WP_003404823.1.71517 WP_003404823.1.71527 WP_003404823.1.71532 WP_003404823.1.71545 WP_003404823.1.71546 WP_003404823.1.71604 WP_003404823.1.71621 WP_003404823.1.71630 WP_003404823.1.71638 WP_003404823.1.71654 WP_003404823.1.71664 WP_003404823.1.71665 WP_003404823.1.71683 WP_003404823.1.71701 WP_003404823.1.71718 WP_003404823.1.71731 WP_003404823.1.71778 WP_003404823.1.71781 WP_003404823.1.71803 WP_003404823.1.71820 WP_003404823.1.71847 WP_003404823.1.7185 WP_003404823.1.71851 WP_003404823.1.71871 WP_003404823.1.71909 WP_003404823.1.71957 WP_003404823.1.71970 WP_003404823.1.72047 WP_003404823.1.72061 WP_003404823.1.72062 WP_003404823.1.72072 WP_003404823.1.72111 WP_003404823.1.72122 WP_003404823.1.72128 WP_003404823.1.72143 WP_003404823.1.7216 WP_003404823.1.72168 WP_003404823.1.72179 WP_003404823.1.72209 WP_003404823.1.72218 WP_003404823.1.72219 WP_003404823.1.72227 WP_003404823.1.7224 WP_003404823.1.72268 WP_003404823.1.72332 WP_003404823.1.72380 WP_003404823.1.72401 WP_003404823.1.72405 WP_003404823.1.72441 WP_003404823.1.72451 WP_003404823.1.72452 WP_003404823.1.72457 WP_003404823.1.72459 WP_003404823.1.72460 WP_003404823.1.72466 WP_003404823.1.72487 WP_003404823.1.72488 WP_003404823.1.72492 WP_003404823.1.72506 WP_003404823.1.72543 WP_003404823.1.7256 WP_003404823.1.72576 WP_003404823.1.72578 WP_003404823.1.72585 WP_003404823.1.72591 WP_003404823.1.72592 WP_003404823.1.72640 WP_003404823.1.7266 WP_003404823.1.72661 WP_003404823.1.72684 WP_003404823.1.72739 WP_003404823.1.72744 WP_003404823.1.72755 WP_003404823.1.72759 WP_003404823.1.72784 WP_003404823.1.72792 WP_003404823.1.72826 WP_003404823.1.72831 WP_003404823.1.72852 WP_003404823.1.72853 WP_003404823.1.72879 WP_003404823.1.72880 WP_003404823.1.72938 WP_003404823.1.72954 WP_003404823.1.72957 WP_003404823.1.72959 WP_003404823.1.72973 WP_003404823.1.7298 WP_003404823.1.72982 WP_003404823.1.72988 WP_003404823.1.72993 WP_003404823.1.73006 WP_003404823.1.73013 WP_003404823.1.73025 WP_003404823.1.73028 WP_003404823.1.73042 WP_003404823.1.73045 WP_003404823.1.73092 WP_003404823.1.73118 WP_003404823.1.7312 WP_003404823.1.73127 WP_003404823.1.73134 WP_003404823.1.73150 WP_003404823.1.73154 WP_003404823.1.73163 WP_003404823.1.73182 WP_003404823.1.73205 WP_003404823.1.7321 WP_003404823.1.73310 WP_003404823.1.73315 WP_003404823.1.73365 WP_003404823.1.73391 WP_003404823.1.73404 WP_003404823.1.73424 WP_003404823.1.73436 WP_003404823.1.73445 WP_003404823.1.73453 WP_003404823.1.73465 WP_003404823.1.73466 WP_003404823.1.73470 WP_003404823.1.73471 WP_003404823.1.73478 WP_003404823.1.73482 WP_003404823.1.73507 WP_003404823.1.73532 WP_003404823.1.73550 WP_003404823.1.73564 WP_003404823.1.73623 WP_003404823.1.73629 WP_003404823.1.73644 WP_003404823.1.7366 WP_003404823.1.73661 WP_003404823.1.7368 WP_003404823.1.73688 WP_003404823.1.73723 WP_003404823.1.73744 WP_003404823.1.73750 WP_003404823.1.73760 WP_003404823.1.73774 WP_003404823.1.7379 WP_003404823.1.73813 WP_003404823.1.73840 WP_003404823.1.73876 WP_003404823.1.7389 WP_003404823.1.73986 WP_003404823.1.74016 WP_003404823.1.74039 WP_003404823.1.74083 WP_003404823.1.74101 WP_003404823.1.74107 WP_003404823.1.74120 WP_003404823.1.74129 WP_003404823.1.74144 WP_003404823.1.7417 WP_003404823.1.74190 WP_003404823.1.74210 WP_003404823.1.7423 WP_003404823.1.74259 WP_003404823.1.74262 WP_003404823.1.74269 WP_003404823.1.74282 WP_003404823.1.74291 WP_003404823.1.74296 WP_003404823.1.74304 WP_003404823.1.7432 WP_003404823.1.74347 WP_003404823.1.7436 WP_003404823.1.74378 WP_003404823.1.74382 WP_003404823.1.74395 WP_003404823.1.74400 WP_003404823.1.74401 WP_003404823.1.74432 WP_003404823.1.74442 WP_003404823.1.74477 WP_003404823.1.74487 WP_003404823.1.74499 WP_003404823.1.74504 WP_003404823.1.74511 WP_003404823.1.74523 WP_003404823.1.74525 WP_003404823.1.74551 WP_003404823.1.74555 WP_003404823.1.74628 WP_003404823.1.74641 WP_003404823.1.74660 WP_003404823.1.74683 WP_003404823.1.7469 WP_003404823.1.74725 WP_003404823.1.74760 WP_003404823.1.74786 WP_003404823.1.74809 WP_003404823.1.74820 WP_003404823.1.74870 WP_003404823.1.74881 WP_003404823.1.74888 WP_003404823.1.74952 WP_003404823.1.7496 WP_003404823.1.74988 WP_003404823.1.75043 WP_003404823.1.75045 WP_003404823.1.75078 WP_003404823.1.75081 WP_003404823.1.75120 WP_003404823.1.75163 WP_003404823.1.75188 WP_003404823.1.75200 WP_003404823.1.75202 WP_003404823.1.75234 WP_003404823.1.75239 WP_003404823.1.75250 WP_003404823.1.75263 WP_003404823.1.75281 WP_003404823.1.75342 WP_003404823.1.7535 WP_003404823.1.75376 WP_003404823.1.75391 WP_003404823.1.75395 WP_003404823.1.75441 WP_003404823.1.75510 WP_003404823.1.75581 WP_003404823.1.75598 WP_003404823.1.75635 WP_003404823.1.75645 WP_003404823.1.75665 WP_003404823.1.75671 WP_003404823.1.75741 WP_003404823.1.75749 WP_003404823.1.75772 WP_003404823.1.75774 WP_003404823.1.75811 WP_003404823.1.75833 WP_003404823.1.7585 WP_003404823.1.75864 WP_003404823.1.75868 WP_003404823.1.75878 WP_003404823.1.75927 WP_003404823.1.75946 WP_003404823.1.75968 WP_003404823.1.75974 WP_003404823.1.76007 WP_003404823.1.76016 WP_003404823.1.76032 WP_003404823.1.76037 WP_003404823.1.7604 WP_003404823.1.76045 WP_003404823.1.76052 WP_003404823.1.76058 WP_003404823.1.76064 WP_003404823.1.76110 WP_003404823.1.76126 WP_003404823.1.76133 WP_003404823.1.76138 WP_003404823.1.76157 WP_003404823.1.76172 WP_003404823.1.76177 WP_003404823.1.76209 WP_003404823.1.76239 WP_003404823.1.76272 WP_003404823.1.76277 WP_003404823.1.76280 WP_003404823.1.76281 WP_003404823.1.76291 WP_003404823.1.76297 WP_003404823.1.76360 WP_003404823.1.76379 WP_003404823.1.76403 WP_003404823.1.76413 WP_003404823.1.76414 WP_003404823.1.76427 WP_003404823.1.76436 WP_003404823.1.76442 WP_003404823.1.76443 WP_003404823.1.76456 WP_003404823.1.76521 WP_003404823.1.76533 WP_003404823.1.76616 WP_003404823.1.76625 WP_003404823.1.76629 WP_003404823.1.76635 WP_003404823.1.76638 WP_003404823.1.76639 WP_003404823.1.76640 WP_003404823.1.76644 WP_003404823.1.76677 WP_003404823.1.76678 WP_003404823.1.76679 WP_003404823.1.76734 WP_003404823.1.76744 WP_003404823.1.76750 WP_003404823.1.76754 WP_003404823.1.76757 WP_003404823.1.76781 WP_003404823.1.76818 WP_003404823.1.76824 WP_003404823.1.76835 WP_003404823.1.76873 WP_003404823.1.76881 WP_003404823.1.76888 WP_003404823.1.76900 WP_003404823.1.76947 WP_003404823.1.76954 WP_003404823.1.76955 WP_003404823.1.76963 WP_003404823.1.76976 WP_003404823.1.770 WP_003404823.1.77000 WP_003404823.1.77008 WP_003404823.1.77021 WP_003404823.1.77056 WP_003404823.1.77065 WP_003404823.1.77075 WP_003404823.1.77093 WP_003404823.1.77115 WP_003404823.1.77118 WP_003404823.1.77125 WP_003404823.1.77141 WP_003404823.1.77142 WP_003404823.1.77166 WP_003404823.1.77250 WP_003404823.1.77252 WP_003404823.1.77260 WP_003404823.1.77266 WP_003404823.1.77280 WP_003404823.1.77285 WP_003404823.1.77312 WP_003404823.1.77348 WP_003404823.1.77351 WP_003404823.1.77352 WP_003404823.1.77361 WP_003404823.1.774 WP_003404823.1.7740 WP_003404823.1.77404 WP_003404823.1.77425 WP_003404823.1.77463 WP_003404823.1.77474 WP_003404823.1.7748 WP_003404823.1.77484 WP_003404823.1.77491 WP_003404823.1.77499 WP_003404823.1.77510 WP_003404823.1.77530 WP_003404823.1.77554 WP_003404823.1.77559 WP_003404823.1.77599 WP_003404823.1.77605 WP_003404823.1.7762 WP_003404823.1.77627 WP_003404823.1.77649 WP_003404823.1.77654 WP_003404823.1.7766 WP_003404823.1.77667 WP_003404823.1.77704 WP_003404823.1.77706 WP_003404823.1.77726 WP_003404823.1.77774 WP_003404823.1.7778 WP_003404823.1.77790 WP_003404823.1.77809 WP_003404823.1.77820 WP_003404823.1.77843 WP_003404823.1.77855 WP_003404823.1.77865 WP_003404823.1.77868 WP_003404823.1.77879 WP_003404823.1.77890 WP_003404823.1.77909 WP_003404823.1.77911 WP_003404823.1.77931 WP_003404823.1.77984 WP_003404823.1.78020 WP_003404823.1.78024 WP_003404823.1.78075 WP_003404823.1.78084 WP_003404823.1.78086 WP_003404823.1.7809 WP_003404823.1.78105 WP_003404823.1.78113 WP_003404823.1.78136 WP_003404823.1.78162 WP_003404823.1.7817 WP_003404823.1.78200 WP_003404823.1.78216 WP_003404823.1.78236 WP_003404823.1.78238 WP_003404823.1.78322 WP_003404823.1.78338 WP_003404823.1.7836 WP_003404823.1.78360 WP_003404823.1.78386 WP_003404823.1.78429 WP_003404823.1.78435 WP_003404823.1.7844 WP_003404823.1.78459 WP_003404823.1.78488 WP_003404823.1.7849 WP_003404823.1.78499 WP_003404823.1.785 WP_003404823.1.78516 WP_003404823.1.78524 WP_003404823.1.78526 WP_003404823.1.78538 WP_003404823.1.78544 WP_003404823.1.78545 WP_003404823.1.78547 WP_003404823.1.78574 WP_003404823.1.78580 WP_003404823.1.7860 WP_003404823.1.78620 WP_003404823.1.78646 WP_003404823.1.78648 WP_003404823.1.78649 WP_003404823.1.78655 WP_003404823.1.78657 WP_003404823.1.78659 WP_003404823.1.7869 WP_003404823.1.78692 WP_003404823.1.78760 WP_003404823.1.78766 WP_003404823.1.78776 WP_003404823.1.78778 WP_003404823.1.78784 WP_003404823.1.78788 WP_003404823.1.78790 WP_003404823.1.78793 WP_003404823.1.78848 WP_003404823.1.78860 WP_003404823.1.7887 WP_003404823.1.78884 WP_003404823.1.78932 WP_003404823.1.78969 WP_003404823.1.78977 WP_003404823.1.78980 WP_003404823.1.79005 WP_003404823.1.79016 WP_003404823.1.79033 WP_003404823.1.79064 WP_003404823.1.79066 WP_003404823.1.79068 WP_003404823.1.79077 WP_003404823.1.79095 WP_003404823.1.79122 WP_003404823.1.79145 WP_003404823.1.79152 WP_003404823.1.79163 WP_003404823.1.79182 WP_003404823.1.79198 WP_003404823.1.79213 WP_003404823.1.79218 WP_003404823.1.79268 WP_003404823.1.79273 WP_003404823.1.79278 WP_003404823.1.79290 WP_003404823.1.79319 WP_003404823.1.79325 WP_003404823.1.79326 WP_003404823.1.7933 WP_003404823.1.79330 WP_003404823.1.79339 WP_003404823.1.79394 WP_003404823.1.79399 WP_003404823.1.79413 WP_003404823.1.79422 WP_003404823.1.79445 WP_003404823.1.79447 WP_003404823.1.79455 WP_003404823.1.79471 WP_003404823.1.79480 WP_003404823.1.79482 WP_003404823.1.79488 WP_003404823.1.79500 WP_003404823.1.79502 WP_003404823.1.79508 WP_003404823.1.79514 WP_003404823.1.79561 WP_003404823.1.79565 WP_003404823.1.79578 WP_003404823.1.79588 WP_003404823.1.79598 WP_003404823.1.79615 WP_003404823.1.79684 WP_003404823.1.79698 WP_003404823.1.797 WP_003404823.1.79744 WP_003404823.1.79784 WP_003404823.1.79802 WP_003404823.1.79806 WP_003404823.1.79819 WP_003404823.1.79826 WP_003404823.1.79828 WP_003404823.1.79851 WP_003404823.1.79853 WP_003404823.1.79863 WP_003404823.1.79881 WP_003404823.1.79885 WP_003404823.1.79898 WP_003404823.1.7990 WP_003404823.1.79900 WP_003404823.1.79913 WP_003404823.1.79918 WP_003404823.1.79947 WP_003404823.1.79948 WP_003404823.1.7995 WP_003404823.1.7997 WP_003404823.1.80004 WP_003404823.1.80015 WP_003404823.1.80022 WP_003404823.1.80030 WP_003404823.1.80054 WP_003404823.1.80084 WP_003404823.1.80099 WP_003404823.1.80129 WP_003404823.1.80177 WP_003404823.1.80234 WP_003404823.1.8026 WP_003404823.1.80275 WP_003404823.1.8029 WP_003404823.1.80300 WP_003404823.1.80304 WP_003404823.1.80326 WP_003404823.1.80351 WP_003404823.1.8037 WP_003404823.1.80370 WP_003404823.1.80387 WP_003404823.1.80399 WP_003404823.1.8044 WP_003404823.1.80451 WP_003404823.1.80458 WP_003404823.1.80461 WP_003404823.1.80490 WP_003404823.1.80503 WP_003404823.1.80507 WP_003404823.1.80552 WP_003404823.1.80576 WP_003404823.1.80588 WP_003404823.1.80599 WP_003404823.1.8060 WP_003404823.1.80624 WP_003404823.1.80636 WP_003404823.1.80673 WP_003404823.1.80711 WP_003404823.1.80714 WP_003404823.1.80743 WP_003404823.1.80784 WP_003404823.1.80815 WP_003404823.1.80853 WP_003404823.1.80918 WP_003404823.1.8093 WP_003404823.1.80967 WP_003404823.1.8097 WP_003404823.1.80988 WP_003404823.1.81007 WP_003404823.1.81013 WP_003404823.1.8105 WP_003404823.1.81059 WP_003404823.1.81063 WP_003404823.1.81066 WP_003404823.1.81075 WP_003404823.1.81091 WP_003404823.1.81119 WP_003404823.1.81125 WP_003404823.1.81136 WP_003404823.1.8114 WP_003404823.1.81189 WP_003404823.1.81192 WP_003404823.1.812 WP_003404823.1.81230 WP_003404823.1.81249 WP_003404823.1.81250 WP_003404823.1.81264 WP_003404823.1.8128 WP_003404823.1.81287 WP_003404823.1.81297 WP_003404823.1.8138 WP_003404823.1.81407 WP_003404823.1.8143 WP_003404823.1.81439 WP_003404823.1.81465 WP_003404823.1.81505 WP_003404823.1.81529 WP_003404823.1.81538 WP_003404823.1.81541 WP_003404823.1.81560 WP_003404823.1.81561 WP_003404823.1.81567 WP_003404823.1.81583 WP_003404823.1.81686 WP_003404823.1.81712 WP_003404823.1.81720 WP_003404823.1.81731 WP_003404823.1.81774 WP_003404823.1.81788 WP_003404823.1.81809 WP_003404823.1.81820 WP_003404823.1.81850 WP_003404823.1.81883 WP_003404823.1.81891 WP_003404823.1.81911 WP_003404823.1.81918 WP_003404823.1.82011 WP_003404823.1.82048 WP_003404823.1.82069 WP_003404823.1.82071 WP_003404823.1.82108 WP_003404823.1.82136 WP_003404823.1.82142 WP_003404823.1.8215 WP_003404823.1.82158 WP_003404823.1.8217 WP_003404823.1.82209 WP_003404823.1.82210 WP_003404823.1.82228 WP_003404823.1.82236 WP_003404823.1.82251 WP_003404823.1.82271 WP_003404823.1.82305 WP_003404823.1.82307 WP_003404823.1.82309 WP_003404823.1.82317 WP_003404823.1.8232 WP_003404823.1.82346 WP_003404823.1.82374 WP_003404823.1.82385 WP_003404823.1.82429 WP_003404823.1.82460 WP_003404823.1.82462 WP_003404823.1.82483 WP_003404823.1.82494 WP_003404823.1.82531 WP_003404823.1.82546 WP_003404823.1.82547 WP_003404823.1.82549 WP_003404823.1.82577 WP_003404823.1.82592 WP_003404823.1.82597 WP_003404823.1.82598 WP_003404823.1.82625 WP_003404823.1.82642 WP_003404823.1.82651 WP_003404823.1.82653 WP_003404823.1.82681 WP_003404823.1.82685 WP_003404823.1.8271 WP_003404823.1.82712 WP_003404823.1.8273 WP_003404823.1.82743 WP_003404823.1.82757 WP_003404823.1.82774 WP_003404823.1.82803 WP_003404823.1.82836 WP_003404823.1.82860 WP_003404823.1.82871 WP_003404823.1.82892 WP_003404823.1.82935 WP_003404823.1.82957 WP_003404823.1.82973 WP_003404823.1.82981 WP_003404823.1.82983 WP_003404823.1.83004 WP_003404823.1.83009 WP_003404823.1.83044 WP_003404823.1.83065 WP_003404823.1.83074 WP_003404823.1.83110 WP_003404823.1.83146 WP_003404823.1.83149 WP_003404823.1.83159 WP_003404823.1.8317 WP_003404823.1.83181 WP_003404823.1.83182 WP_003404823.1.83191 WP_003404823.1.83197 WP_003404823.1.83212 WP_003404823.1.8326 WP_003404823.1.83268 WP_003404823.1.83273 WP_003404823.1.83309 WP_003404823.1.83332 WP_003404823.1.83334 WP_003404823.1.83341 WP_003404823.1.83349 WP_003404823.1.8335 WP_003404823.1.83353 WP_003404823.1.83367 WP_003404823.1.83380 WP_003404823.1.83381 WP_003404823.1.83389 WP_003404823.1.83408 WP_003404823.1.83409 WP_003404823.1.83435 WP_003404823.1.83470 WP_003404823.1.83524 WP_003404823.1.83526 WP_003404823.1.8358 WP_003404823.1.83601 WP_003404823.1.83611 WP_003404823.1.83638 WP_003404823.1.83648 WP_003404823.1.83656 WP_003404823.1.83667 WP_003404823.1.83689 WP_003404823.1.83692 WP_003404823.1.83704 WP_003404823.1.83766 WP_003404823.1.83793 WP_003404823.1.83794 WP_003404823.1.83802 WP_003404823.1.83805 WP_003404823.1.83839 WP_003404823.1.83842 WP_003404823.1.83850 WP_003404823.1.83861 WP_003404823.1.83884 WP_003404823.1.83920 WP_003404823.1.83929 WP_003404823.1.83930 WP_003404823.1.83975 WP_003404823.1.83991 WP_003404823.1.8400 WP_003404823.1.84027 WP_003404823.1.8404 WP_003404823.1.84057 WP_003404823.1.84070 WP_003404823.1.8409 WP_003404823.1.84112 WP_003404823.1.84146 WP_003404823.1.8415 WP_003404823.1.84176 WP_003404823.1.84186 WP_003404823.1.84192 WP_003404823.1.84228 WP_003404823.1.8424 WP_003404823.1.84244 WP_003404823.1.84259 WP_003404823.1.8426 WP_003404823.1.84277 WP_003404823.1.84287 WP_003404823.1.8434 WP_003404823.1.84388 WP_003404823.1.84408 WP_003404823.1.84409 WP_003404823.1.84438 WP_003404823.1.84460 WP_003404823.1.84488 WP_003404823.1.84504 WP_003404823.1.84525 WP_003404823.1.84623 WP_003404823.1.84641 WP_003404823.1.84655 WP_003404823.1.84666 WP_003404823.1.84670 WP_003404823.1.84739 WP_003404823.1.84748 WP_003404823.1.84766 WP_003404823.1.84772 WP_003404823.1.84774 WP_003404823.1.848 WP_003404823.1.84812 WP_003404823.1.84836 WP_003404823.1.84839 WP_003404823.1.84846 WP_003404823.1.84873 WP_003404823.1.84911 WP_003404823.1.84938 WP_003404823.1.84968 WP_003404823.1.84973 WP_003404823.1.84981 WP_003404823.1.84985 WP_003404823.1.8503 WP_003404823.1.85038 WP_003404823.1.85041 WP_003404823.1.85043 WP_003404823.1.8505 WP_003404823.1.85074 WP_003404823.1.8512 WP_003404823.1.85148 WP_003404823.1.8518 WP_003404823.1.8522 WP_003404823.1.85242 WP_003404823.1.85276 WP_003404823.1.85281 WP_003404823.1.85284 WP_003404823.1.85314 WP_003404823.1.85319 WP_003404823.1.85330 WP_003404823.1.85341 WP_003404823.1.85346 WP_003404823.1.8535 WP_003404823.1.85363 WP_003404823.1.85371 WP_003404823.1.85377 WP_003404823.1.85387 WP_003404823.1.85399 WP_003404823.1.85458 WP_003404823.1.8546 WP_003404823.1.85464 WP_003404823.1.85478 WP_003404823.1.85480 WP_003404823.1.85488 WP_003404823.1.85495 WP_003404823.1.85551 WP_003404823.1.85557 WP_003404823.1.85577 WP_003404823.1.85597 WP_003404823.1.85599 WP_003404823.1.85610 WP_003404823.1.8563 WP_003404823.1.85648 WP_003404823.1.85679 WP_003404823.1.85704 WP_003404823.1.85717 WP_003404823.1.85727 WP_003404823.1.85737 WP_003404823.1.85763 WP_003404823.1.85808 WP_003404823.1.85820 WP_003404823.1.85823 WP_003404823.1.85832 WP_003404823.1.8586 WP_003404823.1.85872 WP_003404823.1.85894 WP_003404823.1.85909 WP_003404823.1.85913 WP_003404823.1.85953 WP_003404823.1.85986 WP_003404823.1.86000 WP_003404823.1.86024 WP_003404823.1.86025 WP_003404823.1.86032 WP_003404823.1.86048 WP_003404823.1.86052 WP_003404823.1.86067 WP_003404823.1.86103 WP_003404823.1.86122 WP_003404823.1.86124 WP_003404823.1.86160 WP_003404823.1.86164 WP_003404823.1.86168 WP_003404823.1.86190 WP_003404823.1.86204 WP_003404823.1.86208 WP_003404823.1.86235 WP_003404823.1.86249 WP_003404823.1.86260 WP_003404823.1.86290 WP_003404823.1.86327 WP_003404823.1.86334 WP_003404823.1.86337 WP_003404823.1.86368 WP_003404823.1.86377 WP_003404823.1.86425 WP_003404823.1.86459 WP_003404823.1.8649 WP_003404823.1.86499 WP_003404823.1.86520 WP_003404823.1.86561 WP_003404823.1.86568 WP_003404823.1.86575 WP_003404823.1.86584 WP_003404823.1.86605 WP_003404823.1.86626 WP_003404823.1.86648 WP_003404823.1.8666 WP_003404823.1.86684 WP_003404823.1.86696 WP_003404823.1.86705 WP_003404823.1.86718 WP_003404823.1.86725 WP_003404823.1.86757 WP_003404823.1.86766 WP_003404823.1.86801 WP_003404823.1.86814 WP_003404823.1.86820 WP_003404823.1.86825 WP_003404823.1.86834 WP_003404823.1.8685 WP_003404823.1.86851 WP_003404823.1.86855 WP_003404823.1.86867 WP_003404823.1.86877 WP_003404823.1.86883 WP_003404823.1.8689 WP_003404823.1.86892 WP_003404823.1.86933 WP_003404823.1.86941 WP_003404823.1.86950 WP_003404823.1.86962 WP_003404823.1.86963 WP_003404823.1.86979 WP_003404823.1.8700 WP_003404823.1.87001 WP_003404823.1.87002 WP_003404823.1.87031 WP_003404823.1.87116 WP_003404823.1.87117 WP_003404823.1.8714 WP_003404823.1.87162 WP_003404823.1.87178 WP_003404823.1.87191 WP_003404823.1.87201 WP_003404823.1.87209 WP_003404823.1.87240 WP_003404823.1.87266 WP_003404823.1.87273 WP_003404823.1.87275 WP_003404823.1.8733 WP_003404823.1.87345 WP_003404823.1.87369 WP_003404823.1.8737 WP_003404823.1.87401 WP_003404823.1.87404 WP_003404823.1.87406 WP_003404823.1.87409 WP_003404823.1.87444 WP_003404823.1.87446 WP_003404823.1.87459 WP_003404823.1.87472 WP_003404823.1.87489 WP_003404823.1.87494 WP_003404823.1.87496 WP_003404823.1.87582 WP_003404823.1.87588 WP_003404823.1.87617 WP_003404823.1.87619 WP_003404823.1.87620 WP_003404823.1.87634 WP_003404823.1.87643 WP_003404823.1.8765 WP_003404823.1.87650 WP_003404823.1.87654 WP_003404823.1.87658 WP_003404823.1.87665 WP_003404823.1.87676 WP_003404823.1.87677 WP_003404823.1.87684 WP_003404823.1.87692 WP_003404823.1.87707 WP_003404823.1.87732 WP_003404823.1.87784 WP_003404823.1.87796 WP_003404823.1.87809 WP_003404823.1.87817 WP_003404823.1.87827 WP_003404823.1.87831 WP_003404823.1.87835 WP_003404823.1.87837 WP_003404823.1.87866 WP_003404823.1.8789 WP_003404823.1.87911 WP_003404823.1.87924 WP_003404823.1.87951 WP_003404823.1.87955 WP_003404823.1.87956 WP_003404823.1.87991 WP_003404823.1.88 WP_003404823.1.88002 WP_003404823.1.88037 WP_003404823.1.88039 WP_003404823.1.88072 WP_003404823.1.88077 WP_003404823.1.88121 WP_003404823.1.88180 WP_003404823.1.88191 WP_003404823.1.88205 WP_003404823.1.88217 WP_003404823.1.88219 WP_003404823.1.88245 WP_003404823.1.88253 WP_003404823.1.88294 WP_003404823.1.88315 WP_003404823.1.88316 WP_003404823.1.88320 WP_003404823.1.88338 WP_003404823.1.8840 WP_003404823.1.88437 WP_003404823.1.88453 WP_003404823.1.88469 WP_003404823.1.88489 WP_003404823.1.88507 WP_003404823.1.88521 WP_003404823.1.88530 WP_003404823.1.88537 WP_003404823.1.88541 WP_003404823.1.88592 WP_003404823.1.88616 WP_003404823.1.8862 WP_003404823.1.88625 WP_003404823.1.88632 WP_003404823.1.88634 WP_003404823.1.88649 WP_003404823.1.8870 WP_003404823.1.88737 WP_003404823.1.88756 WP_003404823.1.888 WP_003404823.1.88824 WP_003404823.1.88886 WP_003404823.1.88965 WP_003404823.1.88985 WP_003404823.1.8902 WP_003404823.1.89025 WP_003404823.1.89041 WP_003404823.1.89046 WP_003404823.1.89082 WP_003404823.1.89162 WP_003404823.1.89168 WP_003404823.1.8917 WP_003404823.1.89193 WP_003404823.1.89205 WP_003404823.1.89207 WP_003404823.1.89225 WP_003404823.1.8925 WP_003404823.1.89277 WP_003404823.1.89286 WP_003404823.1.89293 WP_003404823.1.89320 WP_003404823.1.8935 WP_003404823.1.89378 WP_003404823.1.89392 WP_003404823.1.89406 WP_003404823.1.8943 WP_003404823.1.89451 WP_003404823.1.89453 WP_003404823.1.89475 WP_003404823.1.89483 WP_003404823.1.895 WP_003404823.1.89513 WP_003404823.1.89517 WP_003404823.1.89522 WP_003404823.1.8954 WP_003404823.1.89543 WP_003404823.1.89567 WP_003404823.1.8957 WP_003404823.1.89572 WP_003404823.1.89607 WP_003404823.1.89613 WP_003404823.1.89625 WP_003404823.1.89648 WP_003404823.1.8967 WP_003404823.1.89670 WP_003404823.1.89676 WP_003404823.1.89729 WP_003404823.1.89739 WP_003404823.1.89762 WP_003404823.1.8977 WP_003404823.1.89802 WP_003404823.1.89808 WP_003404823.1.8982 WP_003404823.1.89829 WP_003404823.1.89831 WP_003404823.1.89844 WP_003404823.1.89849 WP_003404823.1.8989 WP_003404823.1.89901 WP_003404823.1.89903 WP_003404823.1.89909 WP_003404823.1.8992 WP_003404823.1.89922 WP_003404823.1.89926 WP_003404823.1.89963 WP_003404823.1.89971 WP_003404823.1.8998 WP_003404823.1.89987 WP_003404823.1.900 WP_003404823.1.90048 WP_003404823.1.9007 WP_003404823.1.90080 WP_003404823.1.90130 WP_003404823.1.90134 WP_003404823.1.90137 WP_003404823.1.90157 WP_003404823.1.90184 WP_003404823.1.90199 WP_003404823.1.90231 WP_003404823.1.90245 WP_003404823.1.90308 WP_003404823.1.90322 WP_003404823.1.90328 WP_003404823.1.90372 WP_003404823.1.90439 WP_003404823.1.90481 WP_003404823.1.90499 WP_003404823.1.9050 WP_003404823.1.90527 WP_003404823.1.90550 WP_003404823.1.90560 WP_003404823.1.90612 WP_003404823.1.90640 WP_003404823.1.90672 WP_003404823.1.90687 WP_003404823.1.90691 WP_003404823.1.90711 WP_003404823.1.90722 WP_003404823.1.90744 WP_003404823.1.9075 WP_003404823.1.90756 WP_003404823.1.90767 WP_003404823.1.90771 WP_003404823.1.90785 WP_003404823.1.90788 WP_003404823.1.90800 WP_003404823.1.90810 WP_003404823.1.90816 WP_003404823.1.90819 WP_003404823.1.9082 WP_003404823.1.90831 WP_003404823.1.90884 WP_003404823.1.90899 WP_003404823.1.90906 WP_003404823.1.90958 WP_003404823.1.90976 WP_003404823.1.90977 WP_003404823.1.90987 WP_003404823.1.9102 WP_003404823.1.91026 WP_003404823.1.91032 WP_003404823.1.91043 WP_003404823.1.91053 WP_003404823.1.91082 WP_003404823.1.91106 WP_003404823.1.91112 WP_003404823.1.91151 WP_003404823.1.91157 WP_003404823.1.91167 WP_003404823.1.91169 WP_003404823.1.91192 WP_003404823.1.91201 WP_003404823.1.91207 WP_003404823.1.91208 WP_003404823.1.91211 WP_003404823.1.91214 WP_003404823.1.91230 WP_003404823.1.91244 WP_003404823.1.91251 WP_003404823.1.91260 WP_003404823.1.91265 WP_003404823.1.9128 WP_003404823.1.91284 WP_003404823.1.91294 WP_003404823.1.91303 WP_003404823.1.91322 WP_003404823.1.91352 WP_003404823.1.91386 WP_003404823.1.9139 WP_003404823.1.91398 WP_003404823.1.91411 WP_003404823.1.91430 WP_003404823.1.91483 WP_003404823.1.91496 WP_003404823.1.91507 WP_003404823.1.91508 WP_003404823.1.91576 WP_003404823.1.91589 WP_003404823.1.91694 WP_003404823.1.91695 WP_003404823.1.91713 WP_003404823.1.91716 WP_003404823.1.91717 WP_003404823.1.91728 WP_003404823.1.91743 WP_003404823.1.91759 WP_003404823.1.91784 WP_003404823.1.91785 WP_003404823.1.91786 WP_003404823.1.91802 WP_003404823.1.91822 WP_003404823.1.91828 WP_003404823.1.9189 WP_003404823.1.91896 WP_003404823.1.9190 WP_003404823.1.91915 WP_003404823.1.91931 WP_003404823.1.91937 WP_003404823.1.91944 WP_003404823.1.91953 WP_003404823.1.91957 WP_003404823.1.91976 WP_003404823.1.91978 WP_003404823.1.92021 WP_003404823.1.92083 WP_003404823.1.92127 WP_003404823.1.92144 WP_003404823.1.92150 WP_003404823.1.92153 WP_003404823.1.92190 WP_003404823.1.92192 WP_003404823.1.92200 WP_003404823.1.92220 WP_003404823.1.92221 WP_003404823.1.92222 WP_003404823.1.92273 WP_003404823.1.92289 WP_003404823.1.9229 WP_003404823.1.92294 WP_003404823.1.92317 WP_003404823.1.92334 WP_003404823.1.92338 WP_003404823.1.92345 WP_003404823.1.92356 WP_003404823.1.92364 WP_003404823.1.92380 WP_003404823.1.92416 WP_003404823.1.92428 WP_003404823.1.92447 WP_003404823.1.92456 WP_003404823.1.92467 WP_003404823.1.92471 WP_003404823.1.92490 WP_003404823.1.92508 WP_003404823.1.9251 WP_003404823.1.92511 WP_003404823.1.92523 WP_003404823.1.92527 WP_003404823.1.92536 WP_003404823.1.92592 WP_003404823.1.92597 WP_003404823.1.92603 WP_003404823.1.92606 WP_003404823.1.92610 WP_003404823.1.92613 WP_003404823.1.9263 WP_003404823.1.9265 WP_003404823.1.92650 WP_003404823.1.92660 WP_003404823.1.92677 WP_003404823.1.92685 WP_003404823.1.92689 WP_003404823.1.92690 WP_003404823.1.92706 WP_003404823.1.92714 WP_003404823.1.92736 WP_003404823.1.9274 WP_003404823.1.92752 WP_003404823.1.92760 WP_003404823.1.92777 WP_003404823.1.92803 WP_003404823.1.92833 WP_003404823.1.92856 WP_003404823.1.92881 WP_003404823.1.92892 WP_003404823.1.92907 WP_003404823.1.92908 WP_003404823.1.9291 WP_003404823.1.92917 WP_003404823.1.92996 WP_003404823.1.93006 WP_003404823.1.93008 WP_003404823.1.93009 WP_003404823.1.93015 WP_003404823.1.93043 WP_003404823.1.9307 WP_003404823.1.93083 WP_003404823.1.93097 WP_003404823.1.93137 WP_003404823.1.93199 WP_003404823.1.93203 WP_003404823.1.93212 WP_003404823.1.93234 WP_003404823.1.93245 WP_003404823.1.93257 WP_003404823.1.93265 WP_003404823.1.93297 WP_003404823.1.93320 WP_003404823.1.93328 WP_003404823.1.93337 WP_003404823.1.93343 WP_003404823.1.93349 WP_003404823.1.93363 WP_003404823.1.93377 WP_003404823.1.9338 WP_003404823.1.93407 WP_003404823.1.93417 WP_003404823.1.93419 WP_003404823.1.93426 WP_003404823.1.9344 WP_003404823.1.93443 WP_003404823.1.93447 WP_003404823.1.93470 WP_003404823.1.93483 WP_003404823.1.93487 WP_003404823.1.93495 WP_003404823.1.93499 WP_003404823.1.93516 WP_003404823.1.93536 WP_003404823.1.93544 WP_003404823.1.93555 WP_003404823.1.93560 WP_003404823.1.93564 WP_003404823.1.9357 WP_003404823.1.93573 WP_003404823.1.93576 WP_003404823.1.93588 WP_003404823.1.9363 WP_003404823.1.93645 WP_003404823.1.93649 WP_003404823.1.93659 WP_003404823.1.93677 WP_003404823.1.9368 WP_003404823.1.93689 WP_003404823.1.93693 WP_003404823.1.93698 WP_003404823.1.93706 WP_003404823.1.9371 WP_003404823.1.93792 WP_003404823.1.93823 WP_003404823.1.93871 WP_003404823.1.9388 WP_003404823.1.93894 WP_003404823.1.93903 WP_003404823.1.93907 WP_003404823.1.93913 WP_003404823.1.93946 WP_003404823.1.93950 WP_003404823.1.93953 WP_003404823.1.93954 WP_003404823.1.93988 WP_003404823.1.9407 WP_003404823.1.94143 WP_003404823.1.94154 WP_003404823.1.94184 WP_003404823.1.94204 WP_003404823.1.94205 WP_003404823.1.94226 WP_003404823.1.94231 WP_003404823.1.94256 WP_003404823.1.94261 WP_003404823.1.94281 WP_003404823.1.94292 WP_003404823.1.94297 WP_003404823.1.9431 WP_003404823.1.94326 WP_003404823.1.94339 WP_003404823.1.94392 WP_003404823.1.94416 WP_003404823.1.94421 WP_003404823.1.94456 WP_003404823.1.94470 WP_003404823.1.94480 WP_003404823.1.94495 WP_003404823.1.94511 WP_003404823.1.94512 WP_003404823.1.94525 WP_003404823.1.94528 WP_003404823.1.946 WP_003404823.1.94602 WP_003404823.1.94623 WP_003404823.1.94629 WP_003404823.1.9465 WP_003404823.1.94673 WP_003404823.1.94714 WP_003404823.1.94730 WP_003404823.1.94736 WP_003404823.1.94776 WP_003404823.1.9478 WP_003404823.1.94834 WP_003404823.1.94852 WP_003404823.1.94872 WP_003404823.1.9488 WP_003404823.1.94902 WP_003404823.1.94916 WP_003404823.1.94979 WP_003404823.1.94994 WP_003404823.1.94996 WP_003404823.1.94998 WP_003404823.1.95007 WP_003404823.1.95010 WP_003404823.1.95015 WP_003404823.1.95034 WP_003404823.1.95068 WP_003404823.1.95081 WP_003404823.1.95082 WP_003404823.1.9509 WP_003404823.1.95096 WP_003404823.1.95112 WP_003404823.1.95138 WP_003404823.1.95179 WP_003404823.1.95188 WP_003404823.1.95190 WP_003404823.1.95234 WP_003404823.1.95241 WP_003404823.1.95245 WP_003404823.1.95257 WP_003404823.1.95279 WP_003404823.1.9531 WP_003404823.1.95335 WP_003404823.1.95344 WP_003404823.1.9535 WP_003404823.1.95370 WP_003404823.1.95392 WP_003404823.1.95416 WP_003404823.1.95417 WP_003404823.1.95454 WP_003404823.1.95455 WP_003404823.1.95491 WP_003404823.1.95497 WP_003404823.1.95508 WP_003404823.1.95509 WP_003404823.1.95529 WP_003404823.1.95556 WP_003404823.1.95557 WP_003404823.1.95565 WP_003404823.1.95578 WP_003404823.1.95580 WP_003404823.1.95585 WP_003404823.1.95643 WP_003404823.1.95679 WP_003404823.1.95685 WP_003404823.1.957 WP_003404823.1.95724 WP_003404823.1.95727 WP_003404823.1.95730 WP_003404823.1.95735 WP_003404823.1.95758 WP_003404823.1.95772 WP_003404823.1.95797 WP_003404823.1.95839 WP_003404823.1.9590 WP_003404823.1.95902 WP_003404823.1.95908 WP_003404823.1.95924 WP_003404823.1.95953 WP_003404823.1.95958 WP_003404823.1.95964 WP_003404823.1.95973 WP_003404823.1.96006 WP_003404823.1.9602 WP_003404823.1.96036 WP_003404823.1.96062 WP_003404823.1.96065 WP_003404823.1.96146 WP_003404823.1.96166 WP_003404823.1.96171 WP_003404823.1.96182 WP_003404823.1.96204 WP_003404823.1.96230 WP_003404823.1.96235 WP_003404823.1.96242 WP_003404823.1.96245 WP_003404823.1.96254 WP_003404823.1.96259 WP_003404823.1.96286 WP_003404823.1.96313 WP_003404823.1.96318 WP_003404823.1.96345 WP_003404823.1.96360 WP_003404823.1.96373 WP_003404823.1.96456 WP_003404823.1.96486 WP_003404823.1.96560 WP_003404823.1.96569 WP_003404823.1.96573 WP_003404823.1.96575 WP_003404823.1.96576 WP_003404823.1.96611 WP_003404823.1.96621 WP_003404823.1.9667 WP_003404823.1.96681 WP_003404823.1.96726 WP_003404823.1.96733 WP_003404823.1.96742 WP_003404823.1.96754 WP_003404823.1.9678 WP_003404823.1.96832 WP_003404823.1.9685 WP_003404823.1.97008 WP_003404823.1.97009 WP_003404823.1.97056 WP_003404823.1.97084 WP_003404823.1.97087 WP_003404823.1.97094 WP_003404823.1.97096 WP_003404823.1.97099 WP_003404823.1.97108 WP_003404823.1.97113 WP_003404823.1.97127 WP_003404823.1.97129 WP_003404823.1.97136 WP_003404823.1.9716 WP_003404823.1.97176 WP_003404823.1.97222 WP_003404823.1.97223 WP_003404823.1.97237 WP_003404823.1.97242 WP_003404823.1.97270 WP_003404823.1.97283 WP_003404823.1.97296 WP_003404823.1.97321 WP_003404823.1.97325 WP_003404823.1.97330 WP_003404823.1.97366 WP_003404823.1.97376 WP_003404823.1.97380 WP_003404823.1.9739 WP_003404823.1.97462 WP_003404823.1.97517 WP_003404823.1.97519 WP_003404823.1.97535 WP_003404823.1.97540 WP_003404823.1.97545 WP_003404823.1.97546 WP_003404823.1.97550 WP_003404823.1.97577 WP_003404823.1.97584 WP_003404823.1.9759 WP_003404823.1.97591 WP_003404823.1.97596 WP_003404823.1.97609 WP_003404823.1.97618 WP_003404823.1.9763 WP_003404823.1.97669 WP_003404823.1.97700 WP_003404823.1.97701 WP_003404823.1.9773 WP_003404823.1.97730 WP_003404823.1.97740 WP_003404823.1.97751 WP_003404823.1.97754 WP_003404823.1.97797 WP_003404823.1.9782 WP_003404823.1.9784 WP_003404823.1.97888 WP_003404823.1.9790 WP_003404823.1.9795 WP_003404823.1.97951 WP_003404823.1.97958 WP_003404823.1.97966 WP_003404823.1.97977 WP_003404823.1.97979 WP_003404823.1.97995 WP_003404823.1.98018 WP_003404823.1.98034 WP_003404823.1.98052 WP_003404823.1.98071 WP_003404823.1.98072 WP_003404823.1.98113 WP_003404823.1.98114 WP_003404823.1.98128 WP_003404823.1.98181 WP_003404823.1.98188 WP_003404823.1.98189 WP_003404823.1.98213 WP_003404823.1.98225 WP_003404823.1.98291 WP_003404823.1.98335 WP_003404823.1.98350 WP_003404823.1.98395 WP_003404823.1.98412 WP_003404823.1.98441 WP_003404823.1.98443 WP_003404823.1.98462 WP_003404823.1.9848 WP_003404823.1.98482 WP_003404823.1.98488 WP_003404823.1.98503 WP_003404823.1.98516 WP_003404823.1.98524 WP_003404823.1.98536 WP_003404823.1.98541 WP_003404823.1.98566 WP_003404823.1.98576 WP_003404823.1.98590 WP_003404823.1.98594 WP_003404823.1.98599 WP_003404823.1.98629 WP_003404823.1.98645 WP_003404823.1.98646 WP_003404823.1.98649 WP_003404823.1.98656 WP_003404823.1.98674 WP_003404823.1.98697 WP_003404823.1.98701 WP_003404823.1.98739 WP_003404823.1.98749 WP_003404823.1.98765 WP_003404823.1.98770 WP_003404823.1.98777 WP_003404823.1.98778 WP_003404823.1.98802 WP_003404823.1.98838 WP_003404823.1.98850 WP_003404823.1.98935 WP_003404823.1.98948 WP_003404823.1.98953 WP_003404823.1.98984 WP_003404823.1.99000 WP_003404823.1.99023 WP_003404823.1.99030 WP_003404823.1.99037 WP_003404823.1.99055 WP_003404823.1.99062 WP_003404823.1.99086 WP_003404823.1.99115 WP_003404823.1.99117 WP_003404823.1.99161 WP_003404823.1.99176 WP_003404823.1.99205 WP_003404823.1.99211 WP_003404823.1.99216 WP_003404823.1.99222 WP_003404823.1.99251 WP_003404823.1.99269 WP_003404823.1.99294 WP_003404823.1.99312 WP_003404823.1.99315 WP_003404823.1.99316 WP_003404823.1.99322 WP_003404823.1.99328 WP_003404823.1.99365 WP_003404823.1.99368 WP_003404823.1.99379 WP_003404823.1.99396 WP_003404823.1.99402 WP_003404823.1.99404 WP_003404823.1.99419 WP_003404823.1.99438 WP_003404823.1.99460 WP_003404823.1.99468 WP_003404823.1.99473 WP_003404823.1.99513 WP_003404823.1.99529 WP_003404823.1.99548 WP_003404823.1.99572 WP_003404823.1.99575 WP_003404823.1.99578 WP_003404823.1.99605 WP_003404823.1.99609 WP_003404823.1.99617 WP_003404823.1.99635 WP_003404823.1.99672 WP_003404823.1.99701 WP_003404823.1.99711 WP_003404823.1.99716 WP_003404823.1.99740 WP_003404823.1.99745 WP_003404823.1.99749 WP_003404823.1.9976 WP_003404823.1.99798 WP_003404823.1.99817 WP_003404823.1.99832 WP_003404823.1.99847 WP_003404823.1.99852 WP_003404823.1.99886 WP_003404823.1.99897 WP_003404823.1.99899 WP_003404823.1.99915 WP_003404823.1.9993 WP_003404823.1.99982 WP_003404823.1.99991 gi|525673722|ref|YP_008225041.1| gi|15608081|ref|NP_215456.1| gi|375297269|ref|YP_005101536.1| gi|392433472|ref|YP_006474516.1| gi|449062983|ref|YP_007430066.1| gi|15608081|ref|NP_215456.1| gi|253800032|ref|YP_003033033.1| gi|392385651|ref|YP_005307280.1| gi|31792130|ref|NP_854623.1| gi|433641065|ref|YP_007286824.1| gi|385997722|ref|YP_005916020.1| gi|197739686|ref|YP_002161000.1| gi|148822150|ref|YP_001286904.1| gi|383306827|ref|YP_005359638.1| 233413.Mb0966c 336982.TBFG_10959 410289.BCG_0995c 419947.MRA_0949 478434.TBMG_03048 561275.JTY_0965 83331.MT0968 83332.Rv0941c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]