SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 410289.BCG_1943 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410289.BCG_1943
Domain Number 1 Region: 32-137
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000163
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 410289.BCG_1943
Sequence length 143
Comment (Mycobacterium bovis BCG Pasteur 1173P2)
Sequence
MRTVAIGPGAGPSSTRPSSQPSDLHSGLRAVTECTGSAVVVHVGGDIDASNEVAWQRLVS
KSAAIAIAPGPFVIDIRDLDFMGSCAYAVLAQESVRCRRRGVNMRLVSNQPIVARTIAAC
GLRRLIPLYAMVETALAPPPSAH
Download sequence
Identical sequences A0A0H3M5X0 A0A1A9E7N7 A0A1R3XZQ1
gi|449063971|ref|YP_007431054.1| MyboA.17065.b gi|31793097|ref|NP_855590.1| WP_010950631.1.101146 WP_010950631.1.101996 WP_010950631.1.11587 WP_010950631.1.12187 WP_010950631.1.12710 WP_010950631.1.12801 WP_010950631.1.14658 WP_010950631.1.15345 WP_010950631.1.16973 WP_010950631.1.17039 WP_010950631.1.17314 WP_010950631.1.1768 WP_010950631.1.22680 WP_010950631.1.23140 WP_010950631.1.23497 WP_010950631.1.24062 WP_010950631.1.25965 WP_010950631.1.26265 WP_010950631.1.26412 WP_010950631.1.27254 WP_010950631.1.29559 WP_010950631.1.3043 WP_010950631.1.30669 WP_010950631.1.30732 WP_010950631.1.32822 WP_010950631.1.34111 WP_010950631.1.34358 WP_010950631.1.35173 WP_010950631.1.35680 WP_010950631.1.36246 WP_010950631.1.36657 WP_010950631.1.38135 WP_010950631.1.38601 WP_010950631.1.41583 WP_010950631.1.42201 WP_010950631.1.42417 WP_010950631.1.44016 WP_010950631.1.48109 WP_010950631.1.50860 WP_010950631.1.50868 WP_010950631.1.54502 WP_010950631.1.56729 WP_010950631.1.57616 WP_010950631.1.58000 WP_010950631.1.58101 WP_010950631.1.61256 WP_010950631.1.61778 WP_010950631.1.62360 WP_010950631.1.64966 WP_010950631.1.66013 WP_010950631.1.66460 WP_010950631.1.69181 WP_010950631.1.71621 WP_010950631.1.71820 WP_010950631.1.72218 WP_010950631.1.72219 WP_010950631.1.7266 WP_010950631.1.74477 WP_010950631.1.76976 WP_010950631.1.77093 WP_010950631.1.77166 WP_010950631.1.77879 WP_010950631.1.78429 WP_010950631.1.78544 WP_010950631.1.78848 WP_010950631.1.83268 WP_010950631.1.83704 WP_010950631.1.84911 WP_010950631.1.8943 WP_010950631.1.89802 WP_010950631.1.9128 WP_010950631.1.91411 WP_010950631.1.91508 WP_010950631.1.93008 WP_010950631.1.94184 WP_010950631.1.95908 WP_010950631.1.96204 WP_010950631.1.97330 WP_010950631.1.97568 WP_010950631.1.97596 WP_010950631.1.99037 WP_010950631.1.99269 gi|378771653|ref|YP_005171386.1| 233413.Mb1939 410289.BCG_1943 561275.JTY_1927 gi|224990294|ref|YP_002644981.1| gi|121637810|ref|YP_978033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]