SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 410289.BCG_2475c from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410289.BCG_2475c
Domain Number 1 Region: 249-509
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.11e-59
Family Pyruvate oxidase and decarboxylase Pyr module 0.046
Further Details:      
 
Domain Number 2 Region: 31-251
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 
Domain Number 3 Region: 524-626
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000157
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 410289.BCG_2475c
Sequence length 653
Comment (Mycobacterium bovis BCG Pasteur 1173P2)
Sequence
MDPNGSGAGPESHDAAFHAAPDRQRLENVVIRFAGDSGDGMQLTGDRFTSEAALFGNDLA
TQPNYPAEIRAPAGTLPGVSSFQIQIADYDILTAGDRPDVLVAMNPAALKANIGDLPLGG
MVIVNSDEFTKRNLTKVGYVTNPLESGELSDYVVHTVAMTTLTLGAVEAIGASKKDGQRA
KNMFALGLLSWMYGRELEHSEAFIREKFARKPEIAEANVLALKAGWNYGETTEAFGTTYE
IPPATLPPGEYRQISGNTALAYGIVVAGQLAGLPVVLGSYPITPASDILHELSKHKNFNV
VTFQAEDEIGGICAALGAAYGGALGVTSTSGPGISLKSEALGLGVMTELPLLVIDVQRGG
PSTGLPTKTEQADLLQALYGRNGESPVAVLAPRSPADCFETALEAVRIAVSYHTPVILLS
DGAIANGSEPWRIPDVNALPPIKHTFAKPGEPFQPYARDRETLARQFAIPGTPGLEHRIG
GLEAANGSGDISYEPTNHDLMVRLRQAKIDGIHVPDLEVDDPTGDAELLLIGWGSSYGPI
GEACRRARRRGTKVAHAHLRYLNPFPANLGEVLRRYPKVVAPELNLGQLAQVLRGKYLVD
VQSVTKVKGVSFLADEIGRFIRAALAGRLAELEQDKTLVARLSAATAGAGANG
Download sequence
Identical sequences A0A0E7YB68 A0A0H3M788 A0A109S8N1 A0A109SPS7 A0A109SYJ2 A0A1R3Y1M4 A0A243QLK0 A5U5F1 F8M231 G0TPE2 M8CKT1 O53182 R4MKC9
gi|378772190|ref|YP_005171923.1| gi|340627469|ref|YP_004745921.1| gi|121638338|ref|YP_978562.1| gi|506926987|ref|YP_008007437.1| gi|544161901|ref|YP_002162362.2| gi|392431936|ref|YP_006472980.1| gi|392387096|ref|YP_005308725.1| gi|494700893|ref|YP_007966375.1| gi|31793636|ref|NP_856129.1| gi|433627588|ref|YP_007261217.1| gi|375295729|ref|YP_005099996.1| gi|385999237|ref|YP_005917536.1| gi|148823655|ref|YP_001288409.1| gi|494696830|ref|YP_007962333.1| gi|224990832|ref|YP_002645519.1| gi|15609592|ref|NP_216971.1| NP_216971.1.84033 WP_003412627.1.100000 WP_003412627.1.100069 WP_003412627.1.100087 WP_003412627.1.10015 WP_003412627.1.100208 WP_003412627.1.100216 WP_003412627.1.10022 WP_003412627.1.100255 WP_003412627.1.100260 WP_003412627.1.100270 WP_003412627.1.100279 WP_003412627.1.100286 WP_003412627.1.100308 WP_003412627.1.100309 WP_003412627.1.100318 WP_003412627.1.100337 WP_003412627.1.100338 WP_003412627.1.10037 WP_003412627.1.100383 WP_003412627.1.100395 WP_003412627.1.1004 WP_003412627.1.100401 WP_003412627.1.100459 WP_003412627.1.100460 WP_003412627.1.100552 WP_003412627.1.100581 WP_003412627.1.100600 WP_003412627.1.100625 WP_003412627.1.10064 WP_003412627.1.100671 WP_003412627.1.100677 WP_003412627.1.100682 WP_003412627.1.100697 WP_003412627.1.100703 WP_003412627.1.100716 WP_003412627.1.100722 WP_003412627.1.100754 WP_003412627.1.100757 WP_003412627.1.100772 WP_003412627.1.1008 WP_003412627.1.100812 WP_003412627.1.100845 WP_003412627.1.100866 WP_003412627.1.100889 WP_003412627.1.10090 WP_003412627.1.100910 WP_003412627.1.100915 WP_003412627.1.100918 WP_003412627.1.100935 WP_003412627.1.100984 WP_003412627.1.100998 WP_003412627.1.101025 WP_003412627.1.101028 WP_003412627.1.10104 WP_003412627.1.101048 WP_003412627.1.101054 WP_003412627.1.101143 WP_003412627.1.101146 WP_003412627.1.10116 WP_003412627.1.101209 WP_003412627.1.10125 WP_003412627.1.101290 WP_003412627.1.101323 WP_003412627.1.101324 WP_003412627.1.101350 WP_003412627.1.101367 WP_003412627.1.101398 WP_003412627.1.101421 WP_003412627.1.10144 WP_003412627.1.101442 WP_003412627.1.10145 WP_003412627.1.101452 WP_003412627.1.101456 WP_003412627.1.101481 WP_003412627.1.101496 WP_003412627.1.101525 WP_003412627.1.101535 WP_003412627.1.101553 WP_003412627.1.101558 WP_003412627.1.10156 WP_003412627.1.101573 WP_003412627.1.101576 WP_003412627.1.10159 WP_003412627.1.101592 WP_003412627.1.101604 WP_003412627.1.101607 WP_003412627.1.101622 WP_003412627.1.101644 WP_003412627.1.101659 WP_003412627.1.101671 WP_003412627.1.101687 WP_003412627.1.101698 WP_003412627.1.10170 WP_003412627.1.101722 WP_003412627.1.101743 WP_003412627.1.101753 WP_003412627.1.101754 WP_003412627.1.101764 WP_003412627.1.101773 WP_003412627.1.101797 WP_003412627.1.101802 WP_003412627.1.101826 WP_003412627.1.101836 WP_003412627.1.101858 WP_003412627.1.101859 WP_003412627.1.101862 WP_003412627.1.101888 WP_003412627.1.101899 WP_003412627.1.1019 WP_003412627.1.10193 WP_003412627.1.101996 WP_003412627.1.102 WP_003412627.1.102008 WP_003412627.1.102017 WP_003412627.1.102053 WP_003412627.1.102055 WP_003412627.1.102063 WP_003412627.1.102099 WP_003412627.1.1021 WP_003412627.1.10211 WP_003412627.1.102119 WP_003412627.1.102121 WP_003412627.1.102143 WP_003412627.1.10216 WP_003412627.1.10253 WP_003412627.1.10262 WP_003412627.1.10272 WP_003412627.1.10277 WP_003412627.1.1033 WP_003412627.1.10350 WP_003412627.1.10362 WP_003412627.1.10376 WP_003412627.1.10396 WP_003412627.1.10414 WP_003412627.1.10421 WP_003412627.1.10430 WP_003412627.1.1044 WP_003412627.1.10440 WP_003412627.1.10471 WP_003412627.1.10472 WP_003412627.1.10489 WP_003412627.1.105 WP_003412627.1.10523 WP_003412627.1.10545 WP_003412627.1.1057 WP_003412627.1.10594 WP_003412627.1.10603 WP_003412627.1.10606 WP_003412627.1.10615 WP_003412627.1.10623 WP_003412627.1.10635 WP_003412627.1.10643 WP_003412627.1.10662 WP_003412627.1.10709 WP_003412627.1.10735 WP_003412627.1.10740 WP_003412627.1.10756 WP_003412627.1.1078 WP_003412627.1.10791 WP_003412627.1.10799 WP_003412627.1.10825 WP_003412627.1.10863 WP_003412627.1.10879 WP_003412627.1.10912 WP_003412627.1.10916 WP_003412627.1.10923 WP_003412627.1.10927 WP_003412627.1.1095 WP_003412627.1.10956 WP_003412627.1.10958 WP_003412627.1.10980 WP_003412627.1.10981 WP_003412627.1.10993 WP_003412627.1.1100 WP_003412627.1.11040 WP_003412627.1.11061 WP_003412627.1.11070 WP_003412627.1.11141 WP_003412627.1.11171 WP_003412627.1.11175 WP_003412627.1.11176 WP_003412627.1.11222 WP_003412627.1.11236 WP_003412627.1.11329 WP_003412627.1.1133 WP_003412627.1.11342 WP_003412627.1.11373 WP_003412627.1.11376 WP_003412627.1.11390 WP_003412627.1.11402 WP_003412627.1.11481 WP_003412627.1.11487 WP_003412627.1.11489 WP_003412627.1.11491 WP_003412627.1.11514 WP_003412627.1.11587 WP_003412627.1.11596 WP_003412627.1.11604 WP_003412627.1.11697 WP_003412627.1.11752 WP_003412627.1.11758 WP_003412627.1.11761 WP_003412627.1.11804 WP_003412627.1.11822 WP_003412627.1.11826 WP_003412627.1.11856 WP_003412627.1.11898 WP_003412627.1.11906 WP_003412627.1.11939 WP_003412627.1.11960 WP_003412627.1.11961 WP_003412627.1.11972 WP_003412627.1.11984 WP_003412627.1.120 WP_003412627.1.12049 WP_003412627.1.12052 WP_003412627.1.12100 WP_003412627.1.12116 WP_003412627.1.12130 WP_003412627.1.12133 WP_003412627.1.12165 WP_003412627.1.12184 WP_003412627.1.12187 WP_003412627.1.12190 WP_003412627.1.12216 WP_003412627.1.12265 WP_003412627.1.12293 WP_003412627.1.12294 WP_003412627.1.123 WP_003412627.1.1231 WP_003412627.1.12327 WP_003412627.1.12338 WP_003412627.1.1236 WP_003412627.1.12371 WP_003412627.1.12372 WP_003412627.1.12389 WP_003412627.1.12406 WP_003412627.1.12421 WP_003412627.1.12424 WP_003412627.1.12464 WP_003412627.1.12479 WP_003412627.1.12523 WP_003412627.1.12526 WP_003412627.1.1255 WP_003412627.1.12550 WP_003412627.1.12563 WP_003412627.1.12611 WP_003412627.1.12669 WP_003412627.1.1267 WP_003412627.1.12672 WP_003412627.1.12692 WP_003412627.1.1271 WP_003412627.1.12710 WP_003412627.1.12768 WP_003412627.1.1279 WP_003412627.1.12794 WP_003412627.1.12801 WP_003412627.1.12804 WP_003412627.1.12821 WP_003412627.1.12841 WP_003412627.1.12854 WP_003412627.1.12871 WP_003412627.1.12901 WP_003412627.1.12947 WP_003412627.1.12957 WP_003412627.1.13028 WP_003412627.1.13043 WP_003412627.1.13086 WP_003412627.1.13087 WP_003412627.1.13090 WP_003412627.1.13096 WP_003412627.1.13163 WP_003412627.1.13175 WP_003412627.1.13183 WP_003412627.1.132 WP_003412627.1.13249 WP_003412627.1.13282 WP_003412627.1.13284 WP_003412627.1.13296 WP_003412627.1.13298 WP_003412627.1.13302 WP_003412627.1.13306 WP_003412627.1.13313 WP_003412627.1.13321 WP_003412627.1.13358 WP_003412627.1.13370 WP_003412627.1.13375 WP_003412627.1.1338 WP_003412627.1.13420 WP_003412627.1.13433 WP_003412627.1.13438 WP_003412627.1.13461 WP_003412627.1.13466 WP_003412627.1.13526 WP_003412627.1.13551 WP_003412627.1.13564 WP_003412627.1.13579 WP_003412627.1.13647 WP_003412627.1.13687 WP_003412627.1.13697 WP_003412627.1.13719 WP_003412627.1.13763 WP_003412627.1.1377 WP_003412627.1.13774 WP_003412627.1.13786 WP_003412627.1.13794 WP_003412627.1.13817 WP_003412627.1.13834 WP_003412627.1.13866 WP_003412627.1.13899 WP_003412627.1.13909 WP_003412627.1.13910 WP_003412627.1.13919 WP_003412627.1.13920 WP_003412627.1.13952 WP_003412627.1.13962 WP_003412627.1.1398 WP_003412627.1.13988 WP_003412627.1.14027 WP_003412627.1.14046 WP_003412627.1.14115 WP_003412627.1.1415 WP_003412627.1.14152 WP_003412627.1.14158 WP_003412627.1.14162 WP_003412627.1.14175 WP_003412627.1.14178 WP_003412627.1.14194 WP_003412627.1.14195 WP_003412627.1.14208 WP_003412627.1.14238 WP_003412627.1.14266 WP_003412627.1.14303 WP_003412627.1.14306 WP_003412627.1.14307 WP_003412627.1.14310 WP_003412627.1.14341 WP_003412627.1.14382 WP_003412627.1.14416 WP_003412627.1.14428 WP_003412627.1.14441 WP_003412627.1.14469 WP_003412627.1.14477 WP_003412627.1.14504 WP_003412627.1.14514 WP_003412627.1.1452 WP_003412627.1.14527 WP_003412627.1.1454 WP_003412627.1.14544 WP_003412627.1.14548 WP_003412627.1.14551 WP_003412627.1.14561 WP_003412627.1.14573 WP_003412627.1.1462 WP_003412627.1.14658 WP_003412627.1.14667 WP_003412627.1.14668 WP_003412627.1.14675 WP_003412627.1.14694 WP_003412627.1.14695 WP_003412627.1.14709 WP_003412627.1.14783 WP_003412627.1.14865 WP_003412627.1.14872 WP_003412627.1.14905 WP_003412627.1.14926 WP_003412627.1.14951 WP_003412627.1.14955 WP_003412627.1.15003 WP_003412627.1.15009 WP_003412627.1.15028 WP_003412627.1.15052 WP_003412627.1.15072 WP_003412627.1.15089 WP_003412627.1.1509 WP_003412627.1.15126 WP_003412627.1.15131 WP_003412627.1.15168 WP_003412627.1.15172 WP_003412627.1.15187 WP_003412627.1.15196 WP_003412627.1.15210 WP_003412627.1.15216 WP_003412627.1.1523 WP_003412627.1.15232 WP_003412627.1.15238 WP_003412627.1.15240 WP_003412627.1.15253 WP_003412627.1.1527 WP_003412627.1.15292 WP_003412627.1.15299 WP_003412627.1.15302 WP_003412627.1.15322 WP_003412627.1.1534 WP_003412627.1.15345 WP_003412627.1.15365 WP_003412627.1.15372 WP_003412627.1.15386 WP_003412627.1.15387 WP_003412627.1.15442 WP_003412627.1.15447 WP_003412627.1.15449 WP_003412627.1.15477 WP_003412627.1.15481 WP_003412627.1.15492 WP_003412627.1.15511 WP_003412627.1.15512 WP_003412627.1.15558 WP_003412627.1.15559 WP_003412627.1.15599 WP_003412627.1.1560 WP_003412627.1.15611 WP_003412627.1.1563 WP_003412627.1.15633 WP_003412627.1.15688 WP_003412627.1.15755 WP_003412627.1.15774 WP_003412627.1.1578 WP_003412627.1.15780 WP_003412627.1.15827 WP_003412627.1.15834 WP_003412627.1.15842 WP_003412627.1.15848 WP_003412627.1.15853 WP_003412627.1.15870 WP_003412627.1.15877 WP_003412627.1.15893 WP_003412627.1.15896 WP_003412627.1.15926 WP_003412627.1.15933 WP_003412627.1.15946 WP_003412627.1.15973 WP_003412627.1.15987 WP_003412627.1.15993 WP_003412627.1.16009 WP_003412627.1.16025 WP_003412627.1.16043 WP_003412627.1.16055 WP_003412627.1.16069 WP_003412627.1.16077 WP_003412627.1.16106 WP_003412627.1.16108 WP_003412627.1.16110 WP_003412627.1.16130 WP_003412627.1.16136 WP_003412627.1.16139 WP_003412627.1.16141 WP_003412627.1.16143 WP_003412627.1.16318 WP_003412627.1.16327 WP_003412627.1.16334 WP_003412627.1.16341 WP_003412627.1.16345 WP_003412627.1.16374 WP_003412627.1.16384 WP_003412627.1.16386 WP_003412627.1.164 WP_003412627.1.1642 WP_003412627.1.16421 WP_003412627.1.16424 WP_003412627.1.16426 WP_003412627.1.16431 WP_003412627.1.16438 WP_003412627.1.1644 WP_003412627.1.16442 WP_003412627.1.16448 WP_003412627.1.16451 WP_003412627.1.16476 WP_003412627.1.16480 WP_003412627.1.16494 WP_003412627.1.1652 WP_003412627.1.16549 WP_003412627.1.16560 WP_003412627.1.16598 WP_003412627.1.16609 WP_003412627.1.16619 WP_003412627.1.16620 WP_003412627.1.16622 WP_003412627.1.16637 WP_003412627.1.1669 WP_003412627.1.16707 WP_003412627.1.16724 WP_003412627.1.16731 WP_003412627.1.16743 WP_003412627.1.1683 WP_003412627.1.16837 WP_003412627.1.16852 WP_003412627.1.16937 WP_003412627.1.16940 WP_003412627.1.16950 WP_003412627.1.16959 WP_003412627.1.16968 WP_003412627.1.16973 WP_003412627.1.16977 WP_003412627.1.16987 WP_003412627.1.17005 WP_003412627.1.17006 WP_003412627.1.17010 WP_003412627.1.17015 WP_003412627.1.17019 WP_003412627.1.17039 WP_003412627.1.17041 WP_003412627.1.17052 WP_003412627.1.17062 WP_003412627.1.1707 WP_003412627.1.17094 WP_003412627.1.17138 WP_003412627.1.17147 WP_003412627.1.17167 WP_003412627.1.17224 WP_003412627.1.17288 WP_003412627.1.17304 WP_003412627.1.17314 WP_003412627.1.17345 WP_003412627.1.17381 WP_003412627.1.17391 WP_003412627.1.17412 WP_003412627.1.1743 WP_003412627.1.17466 WP_003412627.1.17477 WP_003412627.1.17483 WP_003412627.1.17505 WP_003412627.1.17527 WP_003412627.1.17535 WP_003412627.1.17540 WP_003412627.1.17553 WP_003412627.1.17558 WP_003412627.1.17599 WP_003412627.1.17635 WP_003412627.1.17655 WP_003412627.1.17679 WP_003412627.1.1768 WP_003412627.1.17687 WP_003412627.1.17700 WP_003412627.1.17710 WP_003412627.1.17713 WP_003412627.1.17722 WP_003412627.1.17746 WP_003412627.1.17798 WP_003412627.1.17816 WP_003412627.1.17821 WP_003412627.1.17830 WP_003412627.1.17868 WP_003412627.1.17878 WP_003412627.1.1792 WP_003412627.1.17923 WP_003412627.1.1795 WP_003412627.1.17955 WP_003412627.1.17973 WP_003412627.1.18009 WP_003412627.1.18013 WP_003412627.1.18033 WP_003412627.1.18057 WP_003412627.1.18065 WP_003412627.1.18070 WP_003412627.1.18116 WP_003412627.1.18120 WP_003412627.1.18126 WP_003412627.1.1817 WP_003412627.1.18170 WP_003412627.1.18206 WP_003412627.1.18216 WP_003412627.1.18240 WP_003412627.1.18257 WP_003412627.1.18297 WP_003412627.1.18306 WP_003412627.1.18364 WP_003412627.1.18399 WP_003412627.1.18411 WP_003412627.1.18448 WP_003412627.1.18467 WP_003412627.1.18476 WP_003412627.1.18522 WP_003412627.1.18580 WP_003412627.1.18582 WP_003412627.1.18587 WP_003412627.1.186 WP_003412627.1.18601 WP_003412627.1.18639 WP_003412627.1.18646 WP_003412627.1.18647 WP_003412627.1.1868 WP_003412627.1.18694 WP_003412627.1.18710 WP_003412627.1.18751 WP_003412627.1.18781 WP_003412627.1.18793 WP_003412627.1.18804 WP_003412627.1.18816 WP_003412627.1.18823 WP_003412627.1.18838 WP_003412627.1.18849 WP_003412627.1.18856 WP_003412627.1.18945 WP_003412627.1.1898 WP_003412627.1.19005 WP_003412627.1.19063 WP_003412627.1.19066 WP_003412627.1.19071 WP_003412627.1.19085 WP_003412627.1.19094 WP_003412627.1.19144 WP_003412627.1.19159 WP_003412627.1.19193 WP_003412627.1.19231 WP_003412627.1.19243 WP_003412627.1.19264 WP_003412627.1.19295 WP_003412627.1.19307 WP_003412627.1.1933 WP_003412627.1.19364 WP_003412627.1.19382 WP_003412627.1.19400 WP_003412627.1.19426 WP_003412627.1.19429 WP_003412627.1.19464 WP_003412627.1.19480 WP_003412627.1.19512 WP_003412627.1.19553 WP_003412627.1.19568 WP_003412627.1.19572 WP_003412627.1.19595 WP_003412627.1.19596 WP_003412627.1.19600 WP_003412627.1.19630 WP_003412627.1.1967 WP_003412627.1.19694 WP_003412627.1.1970 WP_003412627.1.19707 WP_003412627.1.19742 WP_003412627.1.19785 WP_003412627.1.19820 WP_003412627.1.19868 WP_003412627.1.19874 WP_003412627.1.19890 WP_003412627.1.19900 WP_003412627.1.19922 WP_003412627.1.19936 WP_003412627.1.19946 WP_003412627.1.19964 WP_003412627.1.20007 WP_003412627.1.20028 WP_003412627.1.2003 WP_003412627.1.20037 WP_003412627.1.20039 WP_003412627.1.20082 WP_003412627.1.20085 WP_003412627.1.20097 WP_003412627.1.20116 WP_003412627.1.20130 WP_003412627.1.20140 WP_003412627.1.20141 WP_003412627.1.20142 WP_003412627.1.20158 WP_003412627.1.20239 WP_003412627.1.20243 WP_003412627.1.20259 WP_003412627.1.20262 WP_003412627.1.20268 WP_003412627.1.20272 WP_003412627.1.20273 WP_003412627.1.20280 WP_003412627.1.20294 WP_003412627.1.20300 WP_003412627.1.20309 WP_003412627.1.20322 WP_003412627.1.2037 WP_003412627.1.20372 WP_003412627.1.20381 WP_003412627.1.204 WP_003412627.1.20427 WP_003412627.1.20432 WP_003412627.1.20457 WP_003412627.1.20459 WP_003412627.1.20460 WP_003412627.1.20542 WP_003412627.1.20578 WP_003412627.1.20624 WP_003412627.1.20628 WP_003412627.1.20707 WP_003412627.1.20729 WP_003412627.1.20742 WP_003412627.1.20751 WP_003412627.1.20776 WP_003412627.1.20843 WP_003412627.1.20850 WP_003412627.1.2086 WP_003412627.1.20868 WP_003412627.1.20876 WP_003412627.1.20897 WP_003412627.1.20898 WP_003412627.1.2090 WP_003412627.1.20911 WP_003412627.1.20916 WP_003412627.1.20921 WP_003412627.1.20926 WP_003412627.1.20951 WP_003412627.1.20970 WP_003412627.1.2104 WP_003412627.1.21127 WP_003412627.1.21135 WP_003412627.1.21173 WP_003412627.1.21187 WP_003412627.1.212 WP_003412627.1.2120 WP_003412627.1.21218 WP_003412627.1.21219 WP_003412627.1.2123 WP_003412627.1.21231 WP_003412627.1.21234 WP_003412627.1.2126 WP_003412627.1.2131 WP_003412627.1.21311 WP_003412627.1.21321 WP_003412627.1.21365 WP_003412627.1.2137 WP_003412627.1.21392 WP_003412627.1.21397 WP_003412627.1.21415 WP_003412627.1.21418 WP_003412627.1.21430 WP_003412627.1.21434 WP_003412627.1.21444 WP_003412627.1.21468 WP_003412627.1.21498 WP_003412627.1.21509 WP_003412627.1.21513 WP_003412627.1.21560 WP_003412627.1.21565 WP_003412627.1.21586 WP_003412627.1.21591 WP_003412627.1.21594 WP_003412627.1.21602 WP_003412627.1.21615 WP_003412627.1.21638 WP_003412627.1.21639 WP_003412627.1.21655 WP_003412627.1.2168 WP_003412627.1.2174 WP_003412627.1.21741 WP_003412627.1.21742 WP_003412627.1.21777 WP_003412627.1.21786 WP_003412627.1.21795 WP_003412627.1.21826 WP_003412627.1.21840 WP_003412627.1.21843 WP_003412627.1.21873 WP_003412627.1.2188 WP_003412627.1.21882 WP_003412627.1.21906 WP_003412627.1.21912 WP_003412627.1.2194 WP_003412627.1.21941 WP_003412627.1.21956 WP_003412627.1.21958 WP_003412627.1.21960 WP_003412627.1.21971 WP_003412627.1.21973 WP_003412627.1.21983 WP_003412627.1.22003 WP_003412627.1.22013 WP_003412627.1.22025 WP_003412627.1.22036 WP_003412627.1.22075 WP_003412627.1.22092 WP_003412627.1.2212 WP_003412627.1.22233 WP_003412627.1.22255 WP_003412627.1.22277 WP_003412627.1.22305 WP_003412627.1.22348 WP_003412627.1.22356 WP_003412627.1.22366 WP_003412627.1.2238 WP_003412627.1.22380 WP_003412627.1.22437 WP_003412627.1.22438 WP_003412627.1.22490 WP_003412627.1.2253 WP_003412627.1.22585 WP_003412627.1.22589 WP_003412627.1.22606 WP_003412627.1.22608 WP_003412627.1.22609 WP_003412627.1.22618 WP_003412627.1.2262 WP_003412627.1.22624 WP_003412627.1.22629 WP_003412627.1.22647 WP_003412627.1.22664 WP_003412627.1.22665 WP_003412627.1.22670 WP_003412627.1.22674 WP_003412627.1.22680 WP_003412627.1.22733 WP_003412627.1.22737 WP_003412627.1.2275 WP_003412627.1.22754 WP_003412627.1.22797 WP_003412627.1.22800 WP_003412627.1.22804 WP_003412627.1.22829 WP_003412627.1.22840 WP_003412627.1.22963 WP_003412627.1.22970 WP_003412627.1.22996 WP_003412627.1.22997 WP_003412627.1.22999 WP_003412627.1.23015 WP_003412627.1.23032 WP_003412627.1.231 WP_003412627.1.23101 WP_003412627.1.2312 WP_003412627.1.23140 WP_003412627.1.23171 WP_003412627.1.23199 WP_003412627.1.2320 WP_003412627.1.23204 WP_003412627.1.23216 WP_003412627.1.23229 WP_003412627.1.2326 WP_003412627.1.23272 WP_003412627.1.23289 WP_003412627.1.2329 WP_003412627.1.23308 WP_003412627.1.23316 WP_003412627.1.23321 WP_003412627.1.23325 WP_003412627.1.23406 WP_003412627.1.23438 WP_003412627.1.23445 WP_003412627.1.23447 WP_003412627.1.23452 WP_003412627.1.23461 WP_003412627.1.2349 WP_003412627.1.23496 WP_003412627.1.23497 WP_003412627.1.23506 WP_003412627.1.23530 WP_003412627.1.23539 WP_003412627.1.23546 WP_003412627.1.23551 WP_003412627.1.23573 WP_003412627.1.23583 WP_003412627.1.23588 WP_003412627.1.23677 WP_003412627.1.23683 WP_003412627.1.23692 WP_003412627.1.23694 WP_003412627.1.2371 WP_003412627.1.23803 WP_003412627.1.23807 WP_003412627.1.23825 WP_003412627.1.23832 WP_003412627.1.2384 WP_003412627.1.23843 WP_003412627.1.23863 WP_003412627.1.2387 WP_003412627.1.23894 WP_003412627.1.23993 WP_003412627.1.2400 WP_003412627.1.24007 WP_003412627.1.24008 WP_003412627.1.24046 WP_003412627.1.24057 WP_003412627.1.24062 WP_003412627.1.24113 WP_003412627.1.24119 WP_003412627.1.24128 WP_003412627.1.24140 WP_003412627.1.24176 WP_003412627.1.24190 WP_003412627.1.24202 WP_003412627.1.24244 WP_003412627.1.24261 WP_003412627.1.24284 WP_003412627.1.24294 WP_003412627.1.24357 WP_003412627.1.24396 WP_003412627.1.24414 WP_003412627.1.24423 WP_003412627.1.2443 WP_003412627.1.24461 WP_003412627.1.24500 WP_003412627.1.24507 WP_003412627.1.24509 WP_003412627.1.24529 WP_003412627.1.24599 WP_003412627.1.24629 WP_003412627.1.24638 WP_003412627.1.24648 WP_003412627.1.2466 WP_003412627.1.24767 WP_003412627.1.24824 WP_003412627.1.24831 WP_003412627.1.24840 WP_003412627.1.24848 WP_003412627.1.24857 WP_003412627.1.2487 WP_003412627.1.24893 WP_003412627.1.24907 WP_003412627.1.24933 WP_003412627.1.24956 WP_003412627.1.24958 WP_003412627.1.24985 WP_003412627.1.2499 WP_003412627.1.25004 WP_003412627.1.2505 WP_003412627.1.25051 WP_003412627.1.2507 WP_003412627.1.25096 WP_003412627.1.25103 WP_003412627.1.25129 WP_003412627.1.25171 WP_003412627.1.25184 WP_003412627.1.25247 WP_003412627.1.25252 WP_003412627.1.25278 WP_003412627.1.25283 WP_003412627.1.25309 WP_003412627.1.25313 WP_003412627.1.25342 WP_003412627.1.25343 WP_003412627.1.25367 WP_003412627.1.25393 WP_003412627.1.25406 WP_003412627.1.25435 WP_003412627.1.25437 WP_003412627.1.25445 WP_003412627.1.25455 WP_003412627.1.25473 WP_003412627.1.25504 WP_003412627.1.25513 WP_003412627.1.25542 WP_003412627.1.25594 WP_003412627.1.25606 WP_003412627.1.2566 WP_003412627.1.25673 WP_003412627.1.25674 WP_003412627.1.25693 WP_003412627.1.25699 WP_003412627.1.25727 WP_003412627.1.25736 WP_003412627.1.25738 WP_003412627.1.25756 WP_003412627.1.2580 WP_003412627.1.25813 WP_003412627.1.25853 WP_003412627.1.25874 WP_003412627.1.25885 WP_003412627.1.25892 WP_003412627.1.25906 WP_003412627.1.25914 WP_003412627.1.25916 WP_003412627.1.2594 WP_003412627.1.25954 WP_003412627.1.25965 WP_003412627.1.26032 WP_003412627.1.26038 WP_003412627.1.26072 WP_003412627.1.26089 WP_003412627.1.26097 WP_003412627.1.26098 WP_003412627.1.26108 WP_003412627.1.26118 WP_003412627.1.26126 WP_003412627.1.2614 WP_003412627.1.26168 WP_003412627.1.26182 WP_003412627.1.26234 WP_003412627.1.26243 WP_003412627.1.26265 WP_003412627.1.26267 WP_003412627.1.26292 WP_003412627.1.26328 WP_003412627.1.26349 WP_003412627.1.26366 WP_003412627.1.26374 WP_003412627.1.26407 WP_003412627.1.26412 WP_003412627.1.26454 WP_003412627.1.26464 WP_003412627.1.2653 WP_003412627.1.26560 WP_003412627.1.26571 WP_003412627.1.2659 WP_003412627.1.26597 WP_003412627.1.26603 WP_003412627.1.26629 WP_003412627.1.26651 WP_003412627.1.26702 WP_003412627.1.26710 WP_003412627.1.26737 WP_003412627.1.26738 WP_003412627.1.26745 WP_003412627.1.26756 WP_003412627.1.2677 WP_003412627.1.26779 WP_003412627.1.26780 WP_003412627.1.26798 WP_003412627.1.26854 WP_003412627.1.26868 WP_003412627.1.26876 WP_003412627.1.26888 WP_003412627.1.26914 WP_003412627.1.26945 WP_003412627.1.26959 WP_003412627.1.26969 WP_003412627.1.26984 WP_003412627.1.26992 WP_003412627.1.27004 WP_003412627.1.27017 WP_003412627.1.27045 WP_003412627.1.27074 WP_003412627.1.27075 WP_003412627.1.27128 WP_003412627.1.27130 WP_003412627.1.27139 WP_003412627.1.27152 WP_003412627.1.27164 WP_003412627.1.27193 WP_003412627.1.27254 WP_003412627.1.27343 WP_003412627.1.27352 WP_003412627.1.27369 WP_003412627.1.27398 WP_003412627.1.27402 WP_003412627.1.27410 WP_003412627.1.27411 WP_003412627.1.27449 WP_003412627.1.27460 WP_003412627.1.27463 WP_003412627.1.2749 WP_003412627.1.27492 WP_003412627.1.27528 WP_003412627.1.27541 WP_003412627.1.27576 WP_003412627.1.27596 WP_003412627.1.2766 WP_003412627.1.277 WP_003412627.1.27724 WP_003412627.1.27730 WP_003412627.1.27736 WP_003412627.1.27743 WP_003412627.1.27750 WP_003412627.1.27771 WP_003412627.1.27779 WP_003412627.1.27795 WP_003412627.1.27803 WP_003412627.1.27819 WP_003412627.1.27915 WP_003412627.1.27935 WP_003412627.1.27962 WP_003412627.1.28092 WP_003412627.1.28106 WP_003412627.1.28131 WP_003412627.1.28142 WP_003412627.1.28159 WP_003412627.1.2816 WP_003412627.1.28161 WP_003412627.1.28192 WP_003412627.1.28202 WP_003412627.1.28241 WP_003412627.1.28242 WP_003412627.1.28251 WP_003412627.1.28255 WP_003412627.1.28269 WP_003412627.1.28276 WP_003412627.1.28293 WP_003412627.1.28331 WP_003412627.1.28367 WP_003412627.1.28378 WP_003412627.1.28391 WP_003412627.1.2842 WP_003412627.1.28448 WP_003412627.1.2847 WP_003412627.1.28471 WP_003412627.1.28473 WP_003412627.1.28493 WP_003412627.1.28497 WP_003412627.1.28530 WP_003412627.1.28545 WP_003412627.1.28561 WP_003412627.1.28567 WP_003412627.1.28585 WP_003412627.1.286 WP_003412627.1.28610 WP_003412627.1.28617 WP_003412627.1.28634 WP_003412627.1.28642 WP_003412627.1.28671 WP_003412627.1.28682 WP_003412627.1.28698 WP_003412627.1.28703 WP_003412627.1.28739 WP_003412627.1.28758 WP_003412627.1.28781 WP_003412627.1.28787 WP_003412627.1.28827 WP_003412627.1.28839 WP_003412627.1.28847 WP_003412627.1.28850 WP_003412627.1.28851 WP_003412627.1.28865 WP_003412627.1.28897 WP_003412627.1.28914 WP_003412627.1.28935 WP_003412627.1.28936 WP_003412627.1.28939 WP_003412627.1.28943 WP_003412627.1.28952 WP_003412627.1.2899 WP_003412627.1.29000 WP_003412627.1.2901 WP_003412627.1.29028 WP_003412627.1.29033 WP_003412627.1.29058 WP_003412627.1.29078 WP_003412627.1.29102 WP_003412627.1.29115 WP_003412627.1.2916 WP_003412627.1.29223 WP_003412627.1.29234 WP_003412627.1.29264 WP_003412627.1.29275 WP_003412627.1.29306 WP_003412627.1.29339 WP_003412627.1.29348 WP_003412627.1.29364 WP_003412627.1.29367 WP_003412627.1.2938 WP_003412627.1.29399 WP_003412627.1.2944 WP_003412627.1.29449 WP_003412627.1.29450 WP_003412627.1.29452 WP_003412627.1.2949 WP_003412627.1.29510 WP_003412627.1.29515 WP_003412627.1.29525 WP_003412627.1.2953 WP_003412627.1.29559 WP_003412627.1.29587 WP_003412627.1.2959 WP_003412627.1.29592 WP_003412627.1.29599 WP_003412627.1.29611 WP_003412627.1.29632 WP_003412627.1.29649 WP_003412627.1.29659 WP_003412627.1.29696 WP_003412627.1.29698 WP_003412627.1.29718 WP_003412627.1.29742 WP_003412627.1.29745 WP_003412627.1.29747 WP_003412627.1.29769 WP_003412627.1.29825 WP_003412627.1.29830 WP_003412627.1.29861 WP_003412627.1.29869 WP_003412627.1.29883 WP_003412627.1.29890 WP_003412627.1.299 WP_003412627.1.29931 WP_003412627.1.29960 WP_003412627.1.3004 WP_003412627.1.30040 WP_003412627.1.30043 WP_003412627.1.30074 WP_003412627.1.30097 WP_003412627.1.30106 WP_003412627.1.30126 WP_003412627.1.30131 WP_003412627.1.30139 WP_003412627.1.30145 WP_003412627.1.30211 WP_003412627.1.30224 WP_003412627.1.30235 WP_003412627.1.30237 WP_003412627.1.3027 WP_003412627.1.30279 WP_003412627.1.30282 WP_003412627.1.30283 WP_003412627.1.30288 WP_003412627.1.30291 WP_003412627.1.30363 WP_003412627.1.30374 WP_003412627.1.30404 WP_003412627.1.3043 WP_003412627.1.30433 WP_003412627.1.30438 WP_003412627.1.30462 WP_003412627.1.30464 WP_003412627.1.30468 WP_003412627.1.30500 WP_003412627.1.3057 WP_003412627.1.30628 WP_003412627.1.30641 WP_003412627.1.30642 WP_003412627.1.30661 WP_003412627.1.30669 WP_003412627.1.30683 WP_003412627.1.30699 WP_003412627.1.30709 WP_003412627.1.30713 WP_003412627.1.30716 WP_003412627.1.30719 WP_003412627.1.30730 WP_003412627.1.30732 WP_003412627.1.30745 WP_003412627.1.30791 WP_003412627.1.308 WP_003412627.1.30807 WP_003412627.1.30818 WP_003412627.1.30824 WP_003412627.1.30848 WP_003412627.1.30888 WP_003412627.1.30901 WP_003412627.1.30903 WP_003412627.1.30912 WP_003412627.1.30913 WP_003412627.1.30914 WP_003412627.1.30977 WP_003412627.1.3100 WP_003412627.1.31002 WP_003412627.1.3101 WP_003412627.1.31034 WP_003412627.1.31047 WP_003412627.1.31070 WP_003412627.1.31074 WP_003412627.1.31127 WP_003412627.1.31184 WP_003412627.1.31199 WP_003412627.1.31226 WP_003412627.1.31230 WP_003412627.1.31233 WP_003412627.1.31263 WP_003412627.1.31264 WP_003412627.1.31270 WP_003412627.1.31287 WP_003412627.1.31290 WP_003412627.1.31304 WP_003412627.1.31346 WP_003412627.1.31354 WP_003412627.1.31390 WP_003412627.1.31414 WP_003412627.1.31417 WP_003412627.1.31428 WP_003412627.1.3143 WP_003412627.1.31458 WP_003412627.1.31483 WP_003412627.1.3149 WP_003412627.1.31498 WP_003412627.1.31507 WP_003412627.1.31537 WP_003412627.1.31548 WP_003412627.1.31569 WP_003412627.1.31573 WP_003412627.1.316 WP_003412627.1.31629 WP_003412627.1.31666 WP_003412627.1.31693 WP_003412627.1.31703 WP_003412627.1.31770 WP_003412627.1.31776 WP_003412627.1.31783 WP_003412627.1.318 WP_003412627.1.3184 WP_003412627.1.31840 WP_003412627.1.31880 WP_003412627.1.31911 WP_003412627.1.31930 WP_003412627.1.31932 WP_003412627.1.31955 WP_003412627.1.31985 WP_003412627.1.31991 WP_003412627.1.31995 WP_003412627.1.32004 WP_003412627.1.32045 WP_003412627.1.32098 WP_003412627.1.32132 WP_003412627.1.32157 WP_003412627.1.32179 WP_003412627.1.32198 WP_003412627.1.32297 WP_003412627.1.32317 WP_003412627.1.32383 WP_003412627.1.32400 WP_003412627.1.32403 WP_003412627.1.32416 WP_003412627.1.32433 WP_003412627.1.32461 WP_003412627.1.32503 WP_003412627.1.32556 WP_003412627.1.32562 WP_003412627.1.32569 WP_003412627.1.32592 WP_003412627.1.32620 WP_003412627.1.32653 WP_003412627.1.32654 WP_003412627.1.3268 WP_003412627.1.32695 WP_003412627.1.32706 WP_003412627.1.32716 WP_003412627.1.32738 WP_003412627.1.32752 WP_003412627.1.32780 WP_003412627.1.32781 WP_003412627.1.32793 WP_003412627.1.32799 WP_003412627.1.32822 WP_003412627.1.32833 WP_003412627.1.32862 WP_003412627.1.32897 WP_003412627.1.32909 WP_003412627.1.32935 WP_003412627.1.32974 WP_003412627.1.33007 WP_003412627.1.3302 WP_003412627.1.33028 WP_003412627.1.33035 WP_003412627.1.33044 WP_003412627.1.33054 WP_003412627.1.33082 WP_003412627.1.33141 WP_003412627.1.33148 WP_003412627.1.33155 WP_003412627.1.33168 WP_003412627.1.3321 WP_003412627.1.33215 WP_003412627.1.3325 WP_003412627.1.3327 WP_003412627.1.33278 WP_003412627.1.33288 WP_003412627.1.33305 WP_003412627.1.3331 WP_003412627.1.33319 WP_003412627.1.33393 WP_003412627.1.33452 WP_003412627.1.33477 WP_003412627.1.3349 WP_003412627.1.33519 WP_003412627.1.33542 WP_003412627.1.33601 WP_003412627.1.33602 WP_003412627.1.33633 WP_003412627.1.33646 WP_003412627.1.33673 WP_003412627.1.3369 WP_003412627.1.33705 WP_003412627.1.33783 WP_003412627.1.33789 WP_003412627.1.3383 WP_003412627.1.33832 WP_003412627.1.33839 WP_003412627.1.33848 WP_003412627.1.3387 WP_003412627.1.33886 WP_003412627.1.33895 WP_003412627.1.33906 WP_003412627.1.33912 WP_003412627.1.33954 WP_003412627.1.3399 WP_003412627.1.34042 WP_003412627.1.3405 WP_003412627.1.34055 WP_003412627.1.34056 WP_003412627.1.34065 WP_003412627.1.3408 WP_003412627.1.34090 WP_003412627.1.34111 WP_003412627.1.34131 WP_003412627.1.34153 WP_003412627.1.34163 WP_003412627.1.34181 WP_003412627.1.34197 WP_003412627.1.34215 WP_003412627.1.34219 WP_003412627.1.34255 WP_003412627.1.34260 WP_003412627.1.34275 WP_003412627.1.343 WP_003412627.1.34347 WP_003412627.1.34358 WP_003412627.1.34392 WP_003412627.1.344 WP_003412627.1.34428 WP_003412627.1.3443 WP_003412627.1.34435 WP_003412627.1.34446 WP_003412627.1.34499 WP_003412627.1.34505 WP_003412627.1.34516 WP_003412627.1.34529 WP_003412627.1.34551 WP_003412627.1.34576 WP_003412627.1.34581 WP_003412627.1.34596 WP_003412627.1.34599 WP_003412627.1.34639 WP_003412627.1.34724 WP_003412627.1.34740 WP_003412627.1.34755 WP_003412627.1.34783 WP_003412627.1.34841 WP_003412627.1.34908 WP_003412627.1.34919 WP_003412627.1.34933 WP_003412627.1.34945 WP_003412627.1.34954 WP_003412627.1.34960 WP_003412627.1.34961 WP_003412627.1.34963 WP_003412627.1.34965 WP_003412627.1.35023 WP_003412627.1.35069 WP_003412627.1.35072 WP_003412627.1.35078 WP_003412627.1.35100 WP_003412627.1.35146 WP_003412627.1.35156 WP_003412627.1.35160 WP_003412627.1.35162 WP_003412627.1.35173 WP_003412627.1.35176 WP_003412627.1.3520 WP_003412627.1.35213 WP_003412627.1.35221 WP_003412627.1.35246 WP_003412627.1.35278 WP_003412627.1.35312 WP_003412627.1.35317 WP_003412627.1.35319 WP_003412627.1.35382 WP_003412627.1.35385 WP_003412627.1.35397 WP_003412627.1.35426 WP_003412627.1.35439 WP_003412627.1.35455 WP_003412627.1.3548 WP_003412627.1.35484 WP_003412627.1.35492 WP_003412627.1.3553 WP_003412627.1.35553 WP_003412627.1.35555 WP_003412627.1.35602 WP_003412627.1.35610 WP_003412627.1.35635 WP_003412627.1.35657 WP_003412627.1.35680 WP_003412627.1.35687 WP_003412627.1.35689 WP_003412627.1.35707 WP_003412627.1.35732 WP_003412627.1.35754 WP_003412627.1.35770 WP_003412627.1.35771 WP_003412627.1.35780 WP_003412627.1.35811 WP_003412627.1.35821 WP_003412627.1.3584 WP_003412627.1.35848 WP_003412627.1.35874 WP_003412627.1.35897 WP_003412627.1.35899 WP_003412627.1.35923 WP_003412627.1.3593 WP_003412627.1.35954 WP_003412627.1.36005 WP_003412627.1.36014 WP_003412627.1.36023 WP_003412627.1.36051 WP_003412627.1.36075 WP_003412627.1.36089 WP_003412627.1.36097 WP_003412627.1.36098 WP_003412627.1.36116 WP_003412627.1.36145 WP_003412627.1.36156 WP_003412627.1.36205 WP_003412627.1.36228 WP_003412627.1.36246 WP_003412627.1.36252 WP_003412627.1.36260 WP_003412627.1.36270 WP_003412627.1.36271 WP_003412627.1.36303 WP_003412627.1.36315 WP_003412627.1.36319 WP_003412627.1.36321 WP_003412627.1.36326 WP_003412627.1.3634 WP_003412627.1.36356 WP_003412627.1.36357 WP_003412627.1.3636 WP_003412627.1.36385 WP_003412627.1.36399 WP_003412627.1.36436 WP_003412627.1.36465 WP_003412627.1.36469 WP_003412627.1.36485 WP_003412627.1.36508 WP_003412627.1.36540 WP_003412627.1.36561 WP_003412627.1.36571 WP_003412627.1.36573 WP_003412627.1.36578 WP_003412627.1.36585 WP_003412627.1.36597 WP_003412627.1.36614 WP_003412627.1.36657 WP_003412627.1.36674 WP_003412627.1.36720 WP_003412627.1.36727 WP_003412627.1.36733 WP_003412627.1.36785 WP_003412627.1.36844 WP_003412627.1.36851 WP_003412627.1.36862 WP_003412627.1.36893 WP_003412627.1.36921 WP_003412627.1.36935 WP_003412627.1.36941 WP_003412627.1.3695 WP_003412627.1.36951 WP_003412627.1.36968 WP_003412627.1.3700 WP_003412627.1.37004 WP_003412627.1.37012 WP_003412627.1.37071 WP_003412627.1.37088 WP_003412627.1.37131 WP_003412627.1.37175 WP_003412627.1.37188 WP_003412627.1.37213 WP_003412627.1.37229 WP_003412627.1.3724 WP_003412627.1.37277 WP_003412627.1.37330 WP_003412627.1.37389 WP_003412627.1.37400 WP_003412627.1.37440 WP_003412627.1.37459 WP_003412627.1.37468 WP_003412627.1.37475 WP_003412627.1.37484 WP_003412627.1.37612 WP_003412627.1.37632 WP_003412627.1.37643 WP_003412627.1.37660 WP_003412627.1.37674 WP_003412627.1.37700 WP_003412627.1.37701 WP_003412627.1.37709 WP_003412627.1.37711 WP_003412627.1.37721 WP_003412627.1.37722 WP_003412627.1.37747 WP_003412627.1.37765 WP_003412627.1.37772 WP_003412627.1.37804 WP_003412627.1.37809 WP_003412627.1.37877 WP_003412627.1.37912 WP_003412627.1.37943 WP_003412627.1.37950 WP_003412627.1.37973 WP_003412627.1.37975 WP_003412627.1.37983 WP_003412627.1.38 WP_003412627.1.38002 WP_003412627.1.3802 WP_003412627.1.38039 WP_003412627.1.38040 WP_003412627.1.38067 WP_003412627.1.38068 WP_003412627.1.38135 WP_003412627.1.38138 WP_003412627.1.38144 WP_003412627.1.38158 WP_003412627.1.38159 WP_003412627.1.38210 WP_003412627.1.38233 WP_003412627.1.38240 WP_003412627.1.38299 WP_003412627.1.38332 WP_003412627.1.38347 WP_003412627.1.38354 WP_003412627.1.38380 WP_003412627.1.38384 WP_003412627.1.38389 WP_003412627.1.38398 WP_003412627.1.38402 WP_003412627.1.38418 WP_003412627.1.38421 WP_003412627.1.38466 WP_003412627.1.38483 WP_003412627.1.3849 WP_003412627.1.385 WP_003412627.1.38530 WP_003412627.1.38535 WP_003412627.1.38539 WP_003412627.1.38594 WP_003412627.1.38601 WP_003412627.1.38611 WP_003412627.1.38638 WP_003412627.1.38646 WP_003412627.1.38648 WP_003412627.1.38654 WP_003412627.1.38659 WP_003412627.1.38660 WP_003412627.1.38666 WP_003412627.1.38671 WP_003412627.1.38672 WP_003412627.1.38677 WP_003412627.1.38750 WP_003412627.1.38772 WP_003412627.1.38812 WP_003412627.1.38821 WP_003412627.1.38844 WP_003412627.1.38863 WP_003412627.1.3889 WP_003412627.1.38894 WP_003412627.1.38909 WP_003412627.1.38939 WP_003412627.1.38974 WP_003412627.1.38975 WP_003412627.1.38991 WP_003412627.1.39025 WP_003412627.1.39072 WP_003412627.1.39095 WP_003412627.1.39106 WP_003412627.1.39165 WP_003412627.1.39174 WP_003412627.1.39176 WP_003412627.1.39178 WP_003412627.1.39190 WP_003412627.1.39201 WP_003412627.1.39207 WP_003412627.1.39211 WP_003412627.1.39236 WP_003412627.1.39239 WP_003412627.1.39252 WP_003412627.1.39295 WP_003412627.1.39306 WP_003412627.1.39359 WP_003412627.1.39364 WP_003412627.1.39400 WP_003412627.1.39447 WP_003412627.1.39450 WP_003412627.1.39455 WP_003412627.1.3949 WP_003412627.1.39521 WP_003412627.1.39560 WP_003412627.1.39592 WP_003412627.1.39593 WP_003412627.1.396 WP_003412627.1.39616 WP_003412627.1.39654 WP_003412627.1.39657 WP_003412627.1.39661 WP_003412627.1.39674 WP_003412627.1.39678 WP_003412627.1.3968 WP_003412627.1.39694 WP_003412627.1.3971 WP_003412627.1.39718 WP_003412627.1.39728 WP_003412627.1.39739 WP_003412627.1.39748 WP_003412627.1.39751 WP_003412627.1.39759 WP_003412627.1.39801 WP_003412627.1.39848 WP_003412627.1.39877 WP_003412627.1.3994 WP_003412627.1.39959 WP_003412627.1.3996 WP_003412627.1.39960 WP_003412627.1.3997 WP_003412627.1.39980 WP_003412627.1.40028 WP_003412627.1.40029 WP_003412627.1.4003 WP_003412627.1.40096 WP_003412627.1.40150 WP_003412627.1.40156 WP_003412627.1.40186 WP_003412627.1.40276 WP_003412627.1.40277 WP_003412627.1.40323 WP_003412627.1.40336 WP_003412627.1.40353 WP_003412627.1.4036 WP_003412627.1.40372 WP_003412627.1.40402 WP_003412627.1.40413 WP_003412627.1.40440 WP_003412627.1.40446 WP_003412627.1.40455 WP_003412627.1.40523 WP_003412627.1.40543 WP_003412627.1.40641 WP_003412627.1.40646 WP_003412627.1.40651 WP_003412627.1.40653 WP_003412627.1.4067 WP_003412627.1.40705 WP_003412627.1.40723 WP_003412627.1.40731 WP_003412627.1.40735 WP_003412627.1.40795 WP_003412627.1.40799 WP_003412627.1.40852 WP_003412627.1.40876 WP_003412627.1.40881 WP_003412627.1.40922 WP_003412627.1.40948 WP_003412627.1.4095 WP_003412627.1.40956 WP_003412627.1.40957 WP_003412627.1.40964 WP_003412627.1.41000 WP_003412627.1.41055 WP_003412627.1.41108 WP_003412627.1.41123 WP_003412627.1.41202 WP_003412627.1.41219 WP_003412627.1.41231 WP_003412627.1.41249 WP_003412627.1.41296 WP_003412627.1.41376 WP_003412627.1.41430 WP_003412627.1.41447 WP_003412627.1.41469 WP_003412627.1.41504 WP_003412627.1.41553 WP_003412627.1.41564 WP_003412627.1.41583 WP_003412627.1.41616 WP_003412627.1.41632 WP_003412627.1.41635 WP_003412627.1.41636 WP_003412627.1.41648 WP_003412627.1.41660 WP_003412627.1.41685 WP_003412627.1.41704 WP_003412627.1.4171 WP_003412627.1.41719 WP_003412627.1.41733 WP_003412627.1.41744 WP_003412627.1.41774 WP_003412627.1.41791 WP_003412627.1.41803 WP_003412627.1.41828 WP_003412627.1.41829 WP_003412627.1.41860 WP_003412627.1.41921 WP_003412627.1.41933 WP_003412627.1.41944 WP_003412627.1.42043 WP_003412627.1.42075 WP_003412627.1.42078 WP_003412627.1.42094 WP_003412627.1.42112 WP_003412627.1.4212 WP_003412627.1.42122 WP_003412627.1.42134 WP_003412627.1.42183 WP_003412627.1.42188 WP_003412627.1.42201 WP_003412627.1.42202 WP_003412627.1.42208 WP_003412627.1.42247 WP_003412627.1.42304 WP_003412627.1.42309 WP_003412627.1.42370 WP_003412627.1.42385 WP_003412627.1.42400 WP_003412627.1.42409 WP_003412627.1.42414 WP_003412627.1.42417 WP_003412627.1.42430 WP_003412627.1.42465 WP_003412627.1.42467 WP_003412627.1.42474 WP_003412627.1.4248 WP_003412627.1.42494 WP_003412627.1.42519 WP_003412627.1.42524 WP_003412627.1.42534 WP_003412627.1.42562 WP_003412627.1.42568 WP_003412627.1.42618 WP_003412627.1.42660 WP_003412627.1.42704 WP_003412627.1.42705 WP_003412627.1.42722 WP_003412627.1.42782 WP_003412627.1.42835 WP_003412627.1.42842 WP_003412627.1.42905 WP_003412627.1.42916 WP_003412627.1.42930 WP_003412627.1.42971 WP_003412627.1.43005 WP_003412627.1.43009 WP_003412627.1.43053 WP_003412627.1.43082 WP_003412627.1.43087 WP_003412627.1.43098 WP_003412627.1.43208 WP_003412627.1.43236 WP_003412627.1.43246 WP_003412627.1.43255 WP_003412627.1.43269 WP_003412627.1.43273 WP_003412627.1.43296 WP_003412627.1.43306 WP_003412627.1.4335 WP_003412627.1.43368 WP_003412627.1.43395 WP_003412627.1.43457 WP_003412627.1.43462 WP_003412627.1.43475 WP_003412627.1.43478 WP_003412627.1.43484 WP_003412627.1.43557 WP_003412627.1.43578 WP_003412627.1.43588 WP_003412627.1.43643 WP_003412627.1.43664 WP_003412627.1.43684 WP_003412627.1.43686 WP_003412627.1.43716 WP_003412627.1.4377 WP_003412627.1.43781 WP_003412627.1.43794 WP_003412627.1.43815 WP_003412627.1.43846 WP_003412627.1.43861 WP_003412627.1.43863 WP_003412627.1.43866 WP_003412627.1.43872 WP_003412627.1.43885 WP_003412627.1.43897 WP_003412627.1.4390 WP_003412627.1.43921 WP_003412627.1.43936 WP_003412627.1.43937 WP_003412627.1.43960 WP_003412627.1.43965 WP_003412627.1.4399 WP_003412627.1.43993 WP_003412627.1.44 WP_003412627.1.44001 WP_003412627.1.44008 WP_003412627.1.44033 WP_003412627.1.44037 WP_003412627.1.44041 WP_003412627.1.44070 WP_003412627.1.44071 WP_003412627.1.44076 WP_003412627.1.44111 WP_003412627.1.44124 WP_003412627.1.44169 WP_003412627.1.44219 WP_003412627.1.44237 WP_003412627.1.44277 WP_003412627.1.44279 WP_003412627.1.44336 WP_003412627.1.44355 WP_003412627.1.44358 WP_003412627.1.4438 WP_003412627.1.44390 WP_003412627.1.44392 WP_003412627.1.44415 WP_003412627.1.44464 WP_003412627.1.44489 WP_003412627.1.44526 WP_003412627.1.44532 WP_003412627.1.44534 WP_003412627.1.44562 WP_003412627.1.44589 WP_003412627.1.44597 WP_003412627.1.44602 WP_003412627.1.44615 WP_003412627.1.4464 WP_003412627.1.44651 WP_003412627.1.44659 WP_003412627.1.44665 WP_003412627.1.44694 WP_003412627.1.44700 WP_003412627.1.44713 WP_003412627.1.44740 WP_003412627.1.44757 WP_003412627.1.4476 WP_003412627.1.44761 WP_003412627.1.44767 WP_003412627.1.44776 WP_003412627.1.44779 WP_003412627.1.44808 WP_003412627.1.44864 WP_003412627.1.44901 WP_003412627.1.44913 WP_003412627.1.4492 WP_003412627.1.44979 WP_003412627.1.44981 WP_003412627.1.45002 WP_003412627.1.45011 WP_003412627.1.4504 WP_003412627.1.45062 WP_003412627.1.45066 WP_003412627.1.45081 WP_003412627.1.45113 WP_003412627.1.45129 WP_003412627.1.45135 WP_003412627.1.45147 WP_003412627.1.45168 WP_003412627.1.4517 WP_003412627.1.45181 WP_003412627.1.45185 WP_003412627.1.45192 WP_003412627.1.45200 WP_003412627.1.45205 WP_003412627.1.45211 WP_003412627.1.45249 WP_003412627.1.4526 WP_003412627.1.45286 WP_003412627.1.45326 WP_003412627.1.45347 WP_003412627.1.45374 WP_003412627.1.454 WP_003412627.1.45407 WP_003412627.1.45451 WP_003412627.1.45453 WP_003412627.1.45463 WP_003412627.1.45470 WP_003412627.1.45474 WP_003412627.1.45491 WP_003412627.1.45510 WP_003412627.1.45584 WP_003412627.1.45590 WP_003412627.1.45619 WP_003412627.1.45626 WP_003412627.1.45631 WP_003412627.1.45666 WP_003412627.1.45697 WP_003412627.1.4571 WP_003412627.1.45731 WP_003412627.1.45743 WP_003412627.1.45765 WP_003412627.1.45776 WP_003412627.1.45783 WP_003412627.1.45805 WP_003412627.1.45815 WP_003412627.1.45867 WP_003412627.1.45884 WP_003412627.1.4590 WP_003412627.1.45923 WP_003412627.1.45926 WP_003412627.1.45963 WP_003412627.1.45989 WP_003412627.1.46025 WP_003412627.1.46083 WP_003412627.1.46090 WP_003412627.1.46092 WP_003412627.1.46100 WP_003412627.1.46101 WP_003412627.1.46103 WP_003412627.1.46127 WP_003412627.1.46128 WP_003412627.1.46129 WP_003412627.1.46141 WP_003412627.1.46150 WP_003412627.1.46201 WP_003412627.1.46226 WP_003412627.1.4624 WP_003412627.1.46253 WP_003412627.1.46268 WP_003412627.1.46285 WP_003412627.1.46300 WP_003412627.1.46313 WP_003412627.1.46336 WP_003412627.1.46365 WP_003412627.1.46370 WP_003412627.1.46381 WP_003412627.1.46402 WP_003412627.1.46411 WP_003412627.1.46442 WP_003412627.1.46453 WP_003412627.1.46463 WP_003412627.1.46478 WP_003412627.1.4653 WP_003412627.1.46532 WP_003412627.1.46539 WP_003412627.1.46568 WP_003412627.1.46585 WP_003412627.1.46609 WP_003412627.1.46625 WP_003412627.1.46642 WP_003412627.1.46647 WP_003412627.1.46674 WP_003412627.1.46724 WP_003412627.1.46758 WP_003412627.1.46773 WP_003412627.1.46777 WP_003412627.1.46786 WP_003412627.1.46792 WP_003412627.1.46847 WP_003412627.1.46851 WP_003412627.1.4687 WP_003412627.1.46936 WP_003412627.1.46980 WP_003412627.1.47012 WP_003412627.1.47066 WP_003412627.1.47077 WP_003412627.1.47083 WP_003412627.1.47106 WP_003412627.1.47142 WP_003412627.1.47147 WP_003412627.1.47166 WP_003412627.1.47178 WP_003412627.1.47179 WP_003412627.1.47194 WP_003412627.1.47207 WP_003412627.1.47210 WP_003412627.1.47262 WP_003412627.1.47402 WP_003412627.1.47502 WP_003412627.1.4751 WP_003412627.1.47511 WP_003412627.1.47537 WP_003412627.1.47540 WP_003412627.1.47568 WP_003412627.1.47572 WP_003412627.1.47588 WP_003412627.1.47636 WP_003412627.1.47653 WP_003412627.1.47679 WP_003412627.1.47681 WP_003412627.1.47690 WP_003412627.1.4771 WP_003412627.1.47717 WP_003412627.1.47743 WP_003412627.1.47773 WP_003412627.1.47776 WP_003412627.1.47805 WP_003412627.1.47832 WP_003412627.1.47847 WP_003412627.1.47858 WP_003412627.1.47861 WP_003412627.1.47868 WP_003412627.1.47893 WP_003412627.1.47899 WP_003412627.1.47912 WP_003412627.1.47926 WP_003412627.1.4794 WP_003412627.1.47943 WP_003412627.1.47959 WP_003412627.1.47974 WP_003412627.1.47993 WP_003412627.1.48004 WP_003412627.1.48039 WP_003412627.1.48050 WP_003412627.1.48101 WP_003412627.1.48109 WP_003412627.1.4813 WP_003412627.1.48130 WP_003412627.1.48143 WP_003412627.1.48155 WP_003412627.1.48170 WP_003412627.1.48173 WP_003412627.1.48177 WP_003412627.1.48185 WP_003412627.1.48219 WP_003412627.1.4823 WP_003412627.1.48256 WP_003412627.1.48264 WP_003412627.1.48287 WP_003412627.1.48330 WP_003412627.1.48333 WP_003412627.1.48348 WP_003412627.1.48354 WP_003412627.1.48372 WP_003412627.1.48383 WP_003412627.1.48388 WP_003412627.1.48419 WP_003412627.1.48423 WP_003412627.1.48443 WP_003412627.1.48450 WP_003412627.1.48462 WP_003412627.1.48543 WP_003412627.1.48550 WP_003412627.1.48605 WP_003412627.1.48618 WP_003412627.1.4863 WP_003412627.1.48648 WP_003412627.1.48658 WP_003412627.1.48666 WP_003412627.1.48687 WP_003412627.1.48779 WP_003412627.1.4878 WP_003412627.1.48798 WP_003412627.1.48802 WP_003412627.1.48826 WP_003412627.1.48831 WP_003412627.1.48843 WP_003412627.1.48857 WP_003412627.1.4890 WP_003412627.1.48946 WP_003412627.1.48979 WP_003412627.1.49017 WP_003412627.1.49048 WP_003412627.1.49059 WP_003412627.1.4906 WP_003412627.1.4907 WP_003412627.1.49103 WP_003412627.1.49110 WP_003412627.1.49111 WP_003412627.1.49112 WP_003412627.1.4919 WP_003412627.1.49251 WP_003412627.1.49254 WP_003412627.1.49291 WP_003412627.1.49296 WP_003412627.1.49335 WP_003412627.1.49337 WP_003412627.1.49419 WP_003412627.1.49426 WP_003412627.1.49437 WP_003412627.1.49439 WP_003412627.1.49474 WP_003412627.1.49506 WP_003412627.1.49516 WP_003412627.1.49523 WP_003412627.1.49526 WP_003412627.1.49532 WP_003412627.1.49588 WP_003412627.1.4959 WP_003412627.1.49678 WP_003412627.1.49687 WP_003412627.1.49699 WP_003412627.1.49709 WP_003412627.1.4971 WP_003412627.1.4972 WP_003412627.1.49736 WP_003412627.1.49746 WP_003412627.1.49764 WP_003412627.1.49773 WP_003412627.1.49796 WP_003412627.1.49816 WP_003412627.1.49839 WP_003412627.1.49857 WP_003412627.1.49878 WP_003412627.1.49880 WP_003412627.1.49944 WP_003412627.1.4999 WP_003412627.1.49990 WP_003412627.1.50068 WP_003412627.1.50077 WP_003412627.1.5008 WP_003412627.1.50081 WP_003412627.1.50122 WP_003412627.1.50126 WP_003412627.1.50149 WP_003412627.1.50162 WP_003412627.1.5018 WP_003412627.1.50194 WP_003412627.1.50235 WP_003412627.1.50249 WP_003412627.1.50265 WP_003412627.1.50271 WP_003412627.1.50324 WP_003412627.1.50347 WP_003412627.1.50372 WP_003412627.1.50398 WP_003412627.1.50407 WP_003412627.1.50444 WP_003412627.1.50472 WP_003412627.1.5048 WP_003412627.1.50498 WP_003412627.1.5050 WP_003412627.1.50554 WP_003412627.1.50601 WP_003412627.1.50610 WP_003412627.1.50632 WP_003412627.1.50633 WP_003412627.1.50642 WP_003412627.1.50655 WP_003412627.1.50659 WP_003412627.1.50689 WP_003412627.1.50692 WP_003412627.1.50714 WP_003412627.1.50729 WP_003412627.1.50756 WP_003412627.1.50784 WP_003412627.1.50794 WP_003412627.1.50841 WP_003412627.1.50860 WP_003412627.1.50868 WP_003412627.1.50877 WP_003412627.1.50981 WP_003412627.1.50987 WP_003412627.1.51003 WP_003412627.1.51009 WP_003412627.1.51037 WP_003412627.1.51074 WP_003412627.1.51082 WP_003412627.1.51101 WP_003412627.1.51116 WP_003412627.1.51149 WP_003412627.1.51157 WP_003412627.1.51213 WP_003412627.1.51232 WP_003412627.1.51239 WP_003412627.1.51247 WP_003412627.1.51266 WP_003412627.1.51279 WP_003412627.1.51291 WP_003412627.1.51294 WP_003412627.1.51301 WP_003412627.1.51329 WP_003412627.1.51391 WP_003412627.1.51445 WP_003412627.1.51455 WP_003412627.1.51466 WP_003412627.1.51468 WP_003412627.1.51478 WP_003412627.1.51497 WP_003412627.1.51520 WP_003412627.1.51593 WP_003412627.1.51628 WP_003412627.1.51647 WP_003412627.1.51696 WP_003412627.1.51721 WP_003412627.1.51788 WP_003412627.1.51795 WP_003412627.1.51801 WP_003412627.1.51817 WP_003412627.1.51819 WP_003412627.1.51854 WP_003412627.1.51923 WP_003412627.1.51942 WP_003412627.1.51948 WP_003412627.1.51963 WP_003412627.1.52000 WP_003412627.1.52001 WP_003412627.1.52003 WP_003412627.1.52006 WP_003412627.1.52036 WP_003412627.1.52038 WP_003412627.1.52046 WP_003412627.1.52059 WP_003412627.1.52069 WP_003412627.1.52082 WP_003412627.1.52102 WP_003412627.1.52106 WP_003412627.1.52166 WP_003412627.1.52168 WP_003412627.1.52173 WP_003412627.1.52178 WP_003412627.1.52206 WP_003412627.1.52216 WP_003412627.1.52238 WP_003412627.1.52241 WP_003412627.1.52280 WP_003412627.1.52314 WP_003412627.1.52385 WP_003412627.1.52390 WP_003412627.1.524 WP_003412627.1.52460 WP_003412627.1.52486 WP_003412627.1.52495 WP_003412627.1.52531 WP_003412627.1.52533 WP_003412627.1.52545 WP_003412627.1.52553 WP_003412627.1.52563 WP_003412627.1.52564 WP_003412627.1.52574 WP_003412627.1.52641 WP_003412627.1.52673 WP_003412627.1.52708 WP_003412627.1.52713 WP_003412627.1.52761 WP_003412627.1.52778 WP_003412627.1.52791 WP_003412627.1.52818 WP_003412627.1.52872 WP_003412627.1.52873 WP_003412627.1.52891 WP_003412627.1.52892 WP_003412627.1.52909 WP_003412627.1.52970 WP_003412627.1.52998 WP_003412627.1.53053 WP_003412627.1.5306 WP_003412627.1.53088 WP_003412627.1.5309 WP_003412627.1.531 WP_003412627.1.53117 WP_003412627.1.53118 WP_003412627.1.53142 WP_003412627.1.53143 WP_003412627.1.53157 WP_003412627.1.53167 WP_003412627.1.53200 WP_003412627.1.53204 WP_003412627.1.53213 WP_003412627.1.53217 WP_003412627.1.53226 WP_003412627.1.53229 WP_003412627.1.53230 WP_003412627.1.53254 WP_003412627.1.53257 WP_003412627.1.5327 WP_003412627.1.53276 WP_003412627.1.53278 WP_003412627.1.533 WP_003412627.1.53302 WP_003412627.1.53306 WP_003412627.1.5335 WP_003412627.1.53353 WP_003412627.1.53381 WP_003412627.1.53413 WP_003412627.1.53458 WP_003412627.1.53460 WP_003412627.1.53480 WP_003412627.1.53517 WP_003412627.1.53522 WP_003412627.1.53525 WP_003412627.1.53526 WP_003412627.1.53553 WP_003412627.1.53606 WP_003412627.1.53609 WP_003412627.1.53628 WP_003412627.1.53643 WP_003412627.1.53667 WP_003412627.1.53730 WP_003412627.1.53742 WP_003412627.1.53743 WP_003412627.1.53754 WP_003412627.1.53775 WP_003412627.1.53787 WP_003412627.1.53803 WP_003412627.1.53818 WP_003412627.1.53822 WP_003412627.1.53853 WP_003412627.1.53865 WP_003412627.1.53888 WP_003412627.1.53900 WP_003412627.1.53914 WP_003412627.1.53952 WP_003412627.1.5398 WP_003412627.1.5408 WP_003412627.1.54093 WP_003412627.1.54099 WP_003412627.1.54125 WP_003412627.1.54141 WP_003412627.1.54162 WP_003412627.1.54179 WP_003412627.1.54206 WP_003412627.1.54218 WP_003412627.1.54225 WP_003412627.1.54241 WP_003412627.1.54245 WP_003412627.1.54247 WP_003412627.1.54275 WP_003412627.1.54280 WP_003412627.1.5429 WP_003412627.1.54294 WP_003412627.1.54314 WP_003412627.1.54347 WP_003412627.1.54351 WP_003412627.1.54370 WP_003412627.1.54449 WP_003412627.1.54502 WP_003412627.1.54514 WP_003412627.1.54519 WP_003412627.1.5452 WP_003412627.1.54531 WP_003412627.1.54537 WP_003412627.1.54553 WP_003412627.1.54555 WP_003412627.1.54575 WP_003412627.1.54633 WP_003412627.1.54686 WP_003412627.1.54687 WP_003412627.1.54705 WP_003412627.1.54730 WP_003412627.1.54732 WP_003412627.1.54797 WP_003412627.1.54807 WP_003412627.1.54836 WP_003412627.1.54838 WP_003412627.1.54860 WP_003412627.1.54888 WP_003412627.1.54897 WP_003412627.1.54905 WP_003412627.1.54909 WP_003412627.1.54937 WP_003412627.1.54939 WP_003412627.1.54944 WP_003412627.1.54953 WP_003412627.1.54964 WP_003412627.1.55015 WP_003412627.1.55022 WP_003412627.1.55023 WP_003412627.1.55051 WP_003412627.1.55072 WP_003412627.1.55088 WP_003412627.1.55106 WP_003412627.1.55126 WP_003412627.1.55128 WP_003412627.1.55140 WP_003412627.1.55150 WP_003412627.1.55210 WP_003412627.1.55227 WP_003412627.1.55248 WP_003412627.1.55257 WP_003412627.1.55258 WP_003412627.1.55279 WP_003412627.1.55307 WP_003412627.1.55326 WP_003412627.1.55328 WP_003412627.1.5533 WP_003412627.1.55345 WP_003412627.1.55396 WP_003412627.1.55398 WP_003412627.1.55441 WP_003412627.1.55459 WP_003412627.1.55501 WP_003412627.1.55504 WP_003412627.1.55578 WP_003412627.1.55626 WP_003412627.1.55641 WP_003412627.1.5569 WP_003412627.1.55723 WP_003412627.1.5574 WP_003412627.1.55772 WP_003412627.1.55802 WP_003412627.1.55807 WP_003412627.1.55819 WP_003412627.1.5583 WP_003412627.1.55849 WP_003412627.1.55860 WP_003412627.1.55882 WP_003412627.1.55894 WP_003412627.1.55909 WP_003412627.1.55977 WP_003412627.1.56028 WP_003412627.1.56057 WP_003412627.1.56060 WP_003412627.1.56132 WP_003412627.1.56163 WP_003412627.1.56178 WP_003412627.1.56287 WP_003412627.1.56292 WP_003412627.1.56327 WP_003412627.1.56341 WP_003412627.1.56359 WP_003412627.1.56365 WP_003412627.1.56443 WP_003412627.1.56473 WP_003412627.1.56478 WP_003412627.1.56500 WP_003412627.1.56517 WP_003412627.1.56534 WP_003412627.1.56577 WP_003412627.1.56593 WP_003412627.1.56637 WP_003412627.1.56670 WP_003412627.1.56697 WP_003412627.1.567 WP_003412627.1.56701 WP_003412627.1.56729 WP_003412627.1.56743 WP_003412627.1.56755 WP_003412627.1.56764 WP_003412627.1.56769 WP_003412627.1.56770 WP_003412627.1.56795 WP_003412627.1.5681 WP_003412627.1.56827 WP_003412627.1.56839 WP_003412627.1.56863 WP_003412627.1.56868 WP_003412627.1.56869 WP_003412627.1.56915 WP_003412627.1.56926 WP_003412627.1.56961 WP_003412627.1.56971 WP_003412627.1.57023 WP_003412627.1.57035 WP_003412627.1.57077 WP_003412627.1.57094 WP_003412627.1.57134 WP_003412627.1.57151 WP_003412627.1.57169 WP_003412627.1.57212 WP_003412627.1.57230 WP_003412627.1.5724 WP_003412627.1.5725 WP_003412627.1.5727 WP_003412627.1.573 WP_003412627.1.57314 WP_003412627.1.57326 WP_003412627.1.57328 WP_003412627.1.57331 WP_003412627.1.57340 WP_003412627.1.57351 WP_003412627.1.57352 WP_003412627.1.57380 WP_003412627.1.57430 WP_003412627.1.5744 WP_003412627.1.57440 WP_003412627.1.5745 WP_003412627.1.57461 WP_003412627.1.57469 WP_003412627.1.57489 WP_003412627.1.575 WP_003412627.1.57509 WP_003412627.1.57519 WP_003412627.1.57525 WP_003412627.1.57551 WP_003412627.1.5758 WP_003412627.1.57596 WP_003412627.1.57604 WP_003412627.1.57616 WP_003412627.1.57617 WP_003412627.1.57619 WP_003412627.1.57627 WP_003412627.1.57642 WP_003412627.1.57667 WP_003412627.1.57675 WP_003412627.1.57689 WP_003412627.1.57708 WP_003412627.1.57794 WP_003412627.1.57821 WP_003412627.1.57825 WP_003412627.1.57843 WP_003412627.1.57906 WP_003412627.1.57924 WP_003412627.1.57930 WP_003412627.1.57960 WP_003412627.1.57964 WP_003412627.1.57991 WP_003412627.1.58000 WP_003412627.1.58086 WP_003412627.1.58101 WP_003412627.1.58103 WP_003412627.1.58108 WP_003412627.1.5811 WP_003412627.1.58121 WP_003412627.1.58145 WP_003412627.1.58164 WP_003412627.1.58174 WP_003412627.1.582 WP_003412627.1.58202 WP_003412627.1.58209 WP_003412627.1.58215 WP_003412627.1.5824 WP_003412627.1.58250 WP_003412627.1.58259 WP_003412627.1.58288 WP_003412627.1.5830 WP_003412627.1.58303 WP_003412627.1.58311 WP_003412627.1.58330 WP_003412627.1.58359 WP_003412627.1.58386 WP_003412627.1.58393 WP_003412627.1.5844 WP_003412627.1.58457 WP_003412627.1.58488 WP_003412627.1.58534 WP_003412627.1.58559 WP_003412627.1.58573 WP_003412627.1.58612 WP_003412627.1.58619 WP_003412627.1.58630 WP_003412627.1.5865 WP_003412627.1.58743 WP_003412627.1.58754 WP_003412627.1.5879 WP_003412627.1.58824 WP_003412627.1.58848 WP_003412627.1.58857 WP_003412627.1.58891 WP_003412627.1.58892 WP_003412627.1.58904 WP_003412627.1.58921 WP_003412627.1.58930 WP_003412627.1.58939 WP_003412627.1.58941 WP_003412627.1.58953 WP_003412627.1.58961 WP_003412627.1.5898 WP_003412627.1.59029 WP_003412627.1.59037 WP_003412627.1.59044 WP_003412627.1.59085 WP_003412627.1.59088 WP_003412627.1.59112 WP_003412627.1.5914 WP_003412627.1.59147 WP_003412627.1.59166 WP_003412627.1.59205 WP_003412627.1.59209 WP_003412627.1.59237 WP_003412627.1.59240 WP_003412627.1.59253 WP_003412627.1.59254 WP_003412627.1.59262 WP_003412627.1.59270 WP_003412627.1.5928 WP_003412627.1.59304 WP_003412627.1.59305 WP_003412627.1.59309 WP_003412627.1.59316 WP_003412627.1.59326 WP_003412627.1.59328 WP_003412627.1.59333 WP_003412627.1.59338 WP_003412627.1.59388 WP_003412627.1.59428 WP_003412627.1.59487 WP_003412627.1.59537 WP_003412627.1.59561 WP_003412627.1.59677 WP_003412627.1.59722 WP_003412627.1.59727 WP_003412627.1.59732 WP_003412627.1.59738 WP_003412627.1.59750 WP_003412627.1.59757 WP_003412627.1.59761 WP_003412627.1.59808 WP_003412627.1.59850 WP_003412627.1.59856 WP_003412627.1.59860 WP_003412627.1.5987 WP_003412627.1.59888 WP_003412627.1.59952 WP_003412627.1.5996 WP_003412627.1.59961 WP_003412627.1.59974 WP_003412627.1.6000 WP_003412627.1.60007 WP_003412627.1.60016 WP_003412627.1.6003 WP_003412627.1.60047 WP_003412627.1.60091 WP_003412627.1.60121 WP_003412627.1.60125 WP_003412627.1.60135 WP_003412627.1.60152 WP_003412627.1.60171 WP_003412627.1.60197 WP_003412627.1.6020 WP_003412627.1.60205 WP_003412627.1.60207 WP_003412627.1.60215 WP_003412627.1.60267 WP_003412627.1.60288 WP_003412627.1.60291 WP_003412627.1.60301 WP_003412627.1.60305 WP_003412627.1.60312 WP_003412627.1.60367 WP_003412627.1.60376 WP_003412627.1.60403 WP_003412627.1.60413 WP_003412627.1.60421 WP_003412627.1.60451 WP_003412627.1.60460 WP_003412627.1.60479 WP_003412627.1.60487 WP_003412627.1.60573 WP_003412627.1.60583 WP_003412627.1.60657 WP_003412627.1.60687 WP_003412627.1.60689 WP_003412627.1.60727 WP_003412627.1.60738 WP_003412627.1.60763 WP_003412627.1.6077 WP_003412627.1.60791 WP_003412627.1.60834 WP_003412627.1.60870 WP_003412627.1.60878 WP_003412627.1.60879 WP_003412627.1.60913 WP_003412627.1.60978 WP_003412627.1.61001 WP_003412627.1.61012 WP_003412627.1.61014 WP_003412627.1.61015 WP_003412627.1.61037 WP_003412627.1.61100 WP_003412627.1.61101 WP_003412627.1.61138 WP_003412627.1.61198 WP_003412627.1.612 WP_003412627.1.61234 WP_003412627.1.61256 WP_003412627.1.61281 WP_003412627.1.61314 WP_003412627.1.61321 WP_003412627.1.61326 WP_003412627.1.61328 WP_003412627.1.61368 WP_003412627.1.61391 WP_003412627.1.61406 WP_003412627.1.61409 WP_003412627.1.61420 WP_003412627.1.61422 WP_003412627.1.61425 WP_003412627.1.61428 WP_003412627.1.61494 WP_003412627.1.61552 WP_003412627.1.61557 WP_003412627.1.61567 WP_003412627.1.61571 WP_003412627.1.61573 WP_003412627.1.61584 WP_003412627.1.61586 WP_003412627.1.6159 WP_003412627.1.61592 WP_003412627.1.6160 WP_003412627.1.61614 WP_003412627.1.6163 WP_003412627.1.61655 WP_003412627.1.61665 WP_003412627.1.61669 WP_003412627.1.61692 WP_003412627.1.61719 WP_003412627.1.61750 WP_003412627.1.61754 WP_003412627.1.61755 WP_003412627.1.61757 WP_003412627.1.61778 WP_003412627.1.6179 WP_003412627.1.61793 WP_003412627.1.61816 WP_003412627.1.61842 WP_003412627.1.61850 WP_003412627.1.61862 WP_003412627.1.61865 WP_003412627.1.61868 WP_003412627.1.61911 WP_003412627.1.61925 WP_003412627.1.61941 WP_003412627.1.61953 WP_003412627.1.61986 WP_003412627.1.61987 WP_003412627.1.61998 WP_003412627.1.62021 WP_003412627.1.62087 WP_003412627.1.62089 WP_003412627.1.62101 WP_003412627.1.62104 WP_003412627.1.6211 WP_003412627.1.62132 WP_003412627.1.62162 WP_003412627.1.62230 WP_003412627.1.62238 WP_003412627.1.62249 WP_003412627.1.62270 WP_003412627.1.62281 WP_003412627.1.62307 WP_003412627.1.6231 WP_003412627.1.62359 WP_003412627.1.62371 WP_003412627.1.62379 WP_003412627.1.62395 WP_003412627.1.62408 WP_003412627.1.62449 WP_003412627.1.62468 WP_003412627.1.6248 WP_003412627.1.62508 WP_003412627.1.62565 WP_003412627.1.62594 WP_003412627.1.62606 WP_003412627.1.62616 WP_003412627.1.62666 WP_003412627.1.62687 WP_003412627.1.62715 WP_003412627.1.62730 WP_003412627.1.62738 WP_003412627.1.62761 WP_003412627.1.62766 WP_003412627.1.62786 WP_003412627.1.62813 WP_003412627.1.62839 WP_003412627.1.62841 WP_003412627.1.62909 WP_003412627.1.62936 WP_003412627.1.6295 WP_003412627.1.62962 WP_003412627.1.63007 WP_003412627.1.63019 WP_003412627.1.63032 WP_003412627.1.63037 WP_003412627.1.63064 WP_003412627.1.63066 WP_003412627.1.6308 WP_003412627.1.63096 WP_003412627.1.63106 WP_003412627.1.6314 WP_003412627.1.63144 WP_003412627.1.63154 WP_003412627.1.63160 WP_003412627.1.63161 WP_003412627.1.63166 WP_003412627.1.63175 WP_003412627.1.63194 WP_003412627.1.6322 WP_003412627.1.63222 WP_003412627.1.63247 WP_003412627.1.6328 WP_003412627.1.63331 WP_003412627.1.63373 WP_003412627.1.63384 WP_003412627.1.63403 WP_003412627.1.63424 WP_003412627.1.63428 WP_003412627.1.6345 WP_003412627.1.63464 WP_003412627.1.63483 WP_003412627.1.63502 WP_003412627.1.63504 WP_003412627.1.63522 WP_003412627.1.63530 WP_003412627.1.63538 WP_003412627.1.63564 WP_003412627.1.63567 WP_003412627.1.63596 WP_003412627.1.63600 WP_003412627.1.63623 WP_003412627.1.63624 WP_003412627.1.63625 WP_003412627.1.63627 WP_003412627.1.63654 WP_003412627.1.63711 WP_003412627.1.63734 WP_003412627.1.63807 WP_003412627.1.63844 WP_003412627.1.63888 WP_003412627.1.63913 WP_003412627.1.63915 WP_003412627.1.63918 WP_003412627.1.63961 WP_003412627.1.63970 WP_003412627.1.64000 WP_003412627.1.64027 WP_003412627.1.64058 WP_003412627.1.64065 WP_003412627.1.6407 WP_003412627.1.64082 WP_003412627.1.64091 WP_003412627.1.64102 WP_003412627.1.64104 WP_003412627.1.64119 WP_003412627.1.64169 WP_003412627.1.6422 WP_003412627.1.64222 WP_003412627.1.64223 WP_003412627.1.64228 WP_003412627.1.64235 WP_003412627.1.64249 WP_003412627.1.6427 WP_003412627.1.64278 WP_003412627.1.64287 WP_003412627.1.64414 WP_003412627.1.64419 WP_003412627.1.6443 WP_003412627.1.64463 WP_003412627.1.64480 WP_003412627.1.64497 WP_003412627.1.64506 WP_003412627.1.64511 WP_003412627.1.64513 WP_003412627.1.64514 WP_003412627.1.64522 WP_003412627.1.64526 WP_003412627.1.64543 WP_003412627.1.6456 WP_003412627.1.64595 WP_003412627.1.64619 WP_003412627.1.64629 WP_003412627.1.6464 WP_003412627.1.64664 WP_003412627.1.64669 WP_003412627.1.64672 WP_003412627.1.64680 WP_003412627.1.64682 WP_003412627.1.64727 WP_003412627.1.64729 WP_003412627.1.64774 WP_003412627.1.64776 WP_003412627.1.64802 WP_003412627.1.64832 WP_003412627.1.6486 WP_003412627.1.64870 WP_003412627.1.64898 WP_003412627.1.64922 WP_003412627.1.64924 WP_003412627.1.6493 WP_003412627.1.64937 WP_003412627.1.64941 WP_003412627.1.64966 WP_003412627.1.64973 WP_003412627.1.65001 WP_003412627.1.65053 WP_003412627.1.65070 WP_003412627.1.65079 WP_003412627.1.65102 WP_003412627.1.65181 WP_003412627.1.65212 WP_003412627.1.65229 WP_003412627.1.6523 WP_003412627.1.65253 WP_003412627.1.65289 WP_003412627.1.65291 WP_003412627.1.65315 WP_003412627.1.65329 WP_003412627.1.65359 WP_003412627.1.6536 WP_003412627.1.65374 WP_003412627.1.65386 WP_003412627.1.65414 WP_003412627.1.65416 WP_003412627.1.65467 WP_003412627.1.65529 WP_003412627.1.65539 WP_003412627.1.65583 WP_003412627.1.65612 WP_003412627.1.65623 WP_003412627.1.65635 WP_003412627.1.65648 WP_003412627.1.65683 WP_003412627.1.65686 WP_003412627.1.65688 WP_003412627.1.65707 WP_003412627.1.65733 WP_003412627.1.65746 WP_003412627.1.65747 WP_003412627.1.65759 WP_003412627.1.65816 WP_003412627.1.65830 WP_003412627.1.65858 WP_003412627.1.65862 WP_003412627.1.65869 WP_003412627.1.65893 WP_003412627.1.65929 WP_003412627.1.65932 WP_003412627.1.65958 WP_003412627.1.65974 WP_003412627.1.66004 WP_003412627.1.66013 WP_003412627.1.6606 WP_003412627.1.66089 WP_003412627.1.66149 WP_003412627.1.66151 WP_003412627.1.66229 WP_003412627.1.66276 WP_003412627.1.66293 WP_003412627.1.66297 WP_003412627.1.66323 WP_003412627.1.66325 WP_003412627.1.6633 WP_003412627.1.66334 WP_003412627.1.66355 WP_003412627.1.66367 WP_003412627.1.66394 WP_003412627.1.66396 WP_003412627.1.66451 WP_003412627.1.66455 WP_003412627.1.66457 WP_003412627.1.66460 WP_003412627.1.66464 WP_003412627.1.66466 WP_003412627.1.66487 WP_003412627.1.66504 WP_003412627.1.66544 WP_003412627.1.66558 WP_003412627.1.66580 WP_003412627.1.66582 WP_003412627.1.66612 WP_003412627.1.66615 WP_003412627.1.66617 WP_003412627.1.66635 WP_003412627.1.66656 WP_003412627.1.66663 WP_003412627.1.66715 WP_003412627.1.66718 WP_003412627.1.66762 WP_003412627.1.66776 WP_003412627.1.66808 WP_003412627.1.66819 WP_003412627.1.66826 WP_003412627.1.66830 WP_003412627.1.66842 WP_003412627.1.66878 WP_003412627.1.66880 WP_003412627.1.66893 WP_003412627.1.66961 WP_003412627.1.6704 WP_003412627.1.67044 WP_003412627.1.67061 WP_003412627.1.67089 WP_003412627.1.67098 WP_003412627.1.67146 WP_003412627.1.67170 WP_003412627.1.67197 WP_003412627.1.67198 WP_003412627.1.6720 WP_003412627.1.67207 WP_003412627.1.67218 WP_003412627.1.67220 WP_003412627.1.67231 WP_003412627.1.6724 WP_003412627.1.67257 WP_003412627.1.67298 WP_003412627.1.67307 WP_003412627.1.67324 WP_003412627.1.67332 WP_003412627.1.67346 WP_003412627.1.67354 WP_003412627.1.67360 WP_003412627.1.67381 WP_003412627.1.67396 WP_003412627.1.67417 WP_003412627.1.67422 WP_003412627.1.67453 WP_003412627.1.67459 WP_003412627.1.6746 WP_003412627.1.67473 WP_003412627.1.67481 WP_003412627.1.67482 WP_003412627.1.67496 WP_003412627.1.67499 WP_003412627.1.67516 WP_003412627.1.67523 WP_003412627.1.67536 WP_003412627.1.67575 WP_003412627.1.67587 WP_003412627.1.67598 WP_003412627.1.67602 WP_003412627.1.67630 WP_003412627.1.67679 WP_003412627.1.67692 WP_003412627.1.67744 WP_003412627.1.6775 WP_003412627.1.67750 WP_003412627.1.6777 WP_003412627.1.67809 WP_003412627.1.67816 WP_003412627.1.67844 WP_003412627.1.67848 WP_003412627.1.67870 WP_003412627.1.67888 WP_003412627.1.67915 WP_003412627.1.67945 WP_003412627.1.67949 WP_003412627.1.67980 WP_003412627.1.67982 WP_003412627.1.68022 WP_003412627.1.68037 WP_003412627.1.68038 WP_003412627.1.68045 WP_003412627.1.68057 WP_003412627.1.68083 WP_003412627.1.68106 WP_003412627.1.68110 WP_003412627.1.68153 WP_003412627.1.68164 WP_003412627.1.68169 WP_003412627.1.68193 WP_003412627.1.68227 WP_003412627.1.68243 WP_003412627.1.68309 WP_003412627.1.68325 WP_003412627.1.68329 WP_003412627.1.68384 WP_003412627.1.68388 WP_003412627.1.68429 WP_003412627.1.6843 WP_003412627.1.68433 WP_003412627.1.68444 WP_003412627.1.68465 WP_003412627.1.68484 WP_003412627.1.68518 WP_003412627.1.68569 WP_003412627.1.68576 WP_003412627.1.68580 WP_003412627.1.68586 WP_003412627.1.68623 WP_003412627.1.68624 WP_003412627.1.68637 WP_003412627.1.68646 WP_003412627.1.68667 WP_003412627.1.68669 WP_003412627.1.68672 WP_003412627.1.68684 WP_003412627.1.68708 WP_003412627.1.6872 WP_003412627.1.68730 WP_003412627.1.68748 WP_003412627.1.68754 WP_003412627.1.6876 WP_003412627.1.68766 WP_003412627.1.68796 WP_003412627.1.68824 WP_003412627.1.68832 WP_003412627.1.68833 WP_003412627.1.68841 WP_003412627.1.68876 WP_003412627.1.68906 WP_003412627.1.68916 WP_003412627.1.68923 WP_003412627.1.68945 WP_003412627.1.6896 WP_003412627.1.68997 WP_003412627.1.69008 WP_003412627.1.69076 WP_003412627.1.69079 WP_003412627.1.6908 WP_003412627.1.69082 WP_003412627.1.69181 WP_003412627.1.69208 WP_003412627.1.69256 WP_003412627.1.69311 WP_003412627.1.69315 WP_003412627.1.69322 WP_003412627.1.69342 WP_003412627.1.6935 WP_003412627.1.6936 WP_003412627.1.69369 WP_003412627.1.69374 WP_003412627.1.69398 WP_003412627.1.69401 WP_003412627.1.69427 WP_003412627.1.69429 WP_003412627.1.6949 WP_003412627.1.6951 WP_003412627.1.69511 WP_003412627.1.69526 WP_003412627.1.69528 WP_003412627.1.69547 WP_003412627.1.69573 WP_003412627.1.69581 WP_003412627.1.6960 WP_003412627.1.69617 WP_003412627.1.69634 WP_003412627.1.69647 WP_003412627.1.69659 WP_003412627.1.69673 WP_003412627.1.69682 WP_003412627.1.69684 WP_003412627.1.69707 WP_003412627.1.69709 WP_003412627.1.69736 WP_003412627.1.69778 WP_003412627.1.69800 WP_003412627.1.69802 WP_003412627.1.69845 WP_003412627.1.69870 WP_003412627.1.69873 WP_003412627.1.69898 WP_003412627.1.69913 WP_003412627.1.69925 WP_003412627.1.69931 WP_003412627.1.69955 WP_003412627.1.69957 WP_003412627.1.69981 WP_003412627.1.69990 WP_003412627.1.70 WP_003412627.1.70000 WP_003412627.1.70017 WP_003412627.1.70032 WP_003412627.1.70055 WP_003412627.1.70072 WP_003412627.1.70131 WP_003412627.1.70132 WP_003412627.1.7022 WP_003412627.1.70255 WP_003412627.1.70271 WP_003412627.1.70274 WP_003412627.1.7029 WP_003412627.1.70325 WP_003412627.1.70328 WP_003412627.1.70356 WP_003412627.1.70364 WP_003412627.1.70368 WP_003412627.1.70369 WP_003412627.1.70418 WP_003412627.1.70422 WP_003412627.1.70435 WP_003412627.1.70444 WP_003412627.1.70463 WP_003412627.1.70471 WP_003412627.1.70480 WP_003412627.1.70494 WP_003412627.1.70498 WP_003412627.1.70525 WP_003412627.1.70573 WP_003412627.1.70610 WP_003412627.1.70615 WP_003412627.1.70618 WP_003412627.1.70622 WP_003412627.1.70668 WP_003412627.1.70699 WP_003412627.1.70704 WP_003412627.1.70757 WP_003412627.1.70782 WP_003412627.1.70796 WP_003412627.1.70834 WP_003412627.1.7084 WP_003412627.1.70840 WP_003412627.1.70864 WP_003412627.1.70915 WP_003412627.1.70955 WP_003412627.1.70958 WP_003412627.1.70964 WP_003412627.1.70976 WP_003412627.1.71015 WP_003412627.1.71026 WP_003412627.1.71063 WP_003412627.1.71076 WP_003412627.1.71083 WP_003412627.1.7111 WP_003412627.1.71118 WP_003412627.1.71128 WP_003412627.1.7113 WP_003412627.1.71191 WP_003412627.1.71255 WP_003412627.1.71258 WP_003412627.1.71289 WP_003412627.1.71326 WP_003412627.1.71329 WP_003412627.1.71399 WP_003412627.1.71414 WP_003412627.1.71440 WP_003412627.1.7146 WP_003412627.1.71464 WP_003412627.1.71490 WP_003412627.1.71492 WP_003412627.1.71509 WP_003412627.1.71516 WP_003412627.1.71517 WP_003412627.1.71527 WP_003412627.1.71532 WP_003412627.1.71545 WP_003412627.1.71546 WP_003412627.1.71569 WP_003412627.1.71604 WP_003412627.1.71621 WP_003412627.1.71630 WP_003412627.1.71638 WP_003412627.1.71654 WP_003412627.1.71664 WP_003412627.1.71665 WP_003412627.1.71701 WP_003412627.1.71718 WP_003412627.1.71731 WP_003412627.1.71778 WP_003412627.1.71781 WP_003412627.1.71803 WP_003412627.1.71820 WP_003412627.1.7185 WP_003412627.1.71851 WP_003412627.1.71871 WP_003412627.1.71909 WP_003412627.1.71957 WP_003412627.1.71970 WP_003412627.1.72047 WP_003412627.1.72061 WP_003412627.1.72062 WP_003412627.1.72072 WP_003412627.1.72111 WP_003412627.1.72122 WP_003412627.1.72128 WP_003412627.1.72143 WP_003412627.1.7216 WP_003412627.1.72168 WP_003412627.1.72179 WP_003412627.1.72218 WP_003412627.1.72219 WP_003412627.1.72268 WP_003412627.1.72332 WP_003412627.1.72401 WP_003412627.1.72405 WP_003412627.1.72420 WP_003412627.1.72441 WP_003412627.1.72451 WP_003412627.1.72452 WP_003412627.1.72457 WP_003412627.1.72459 WP_003412627.1.72460 WP_003412627.1.72466 WP_003412627.1.72488 WP_003412627.1.72492 WP_003412627.1.72506 WP_003412627.1.72543 WP_003412627.1.72576 WP_003412627.1.72578 WP_003412627.1.72592 WP_003412627.1.72640 WP_003412627.1.7266 WP_003412627.1.72661 WP_003412627.1.72684 WP_003412627.1.72744 WP_003412627.1.72755 WP_003412627.1.72759 WP_003412627.1.72784 WP_003412627.1.72826 WP_003412627.1.72852 WP_003412627.1.72853 WP_003412627.1.72879 WP_003412627.1.72880 WP_003412627.1.72938 WP_003412627.1.72954 WP_003412627.1.72957 WP_003412627.1.72959 WP_003412627.1.72973 WP_003412627.1.7298 WP_003412627.1.72982 WP_003412627.1.72988 WP_003412627.1.72993 WP_003412627.1.73006 WP_003412627.1.73013 WP_003412627.1.73025 WP_003412627.1.73028 WP_003412627.1.73042 WP_003412627.1.73045 WP_003412627.1.73092 WP_003412627.1.73118 WP_003412627.1.7312 WP_003412627.1.73134 WP_003412627.1.73150 WP_003412627.1.73154 WP_003412627.1.73163 WP_003412627.1.73182 WP_003412627.1.73205 WP_003412627.1.7321 WP_003412627.1.73310 WP_003412627.1.73365 WP_003412627.1.73391 WP_003412627.1.73424 WP_003412627.1.73436 WP_003412627.1.73445 WP_003412627.1.73453 WP_003412627.1.73465 WP_003412627.1.73466 WP_003412627.1.73470 WP_003412627.1.73478 WP_003412627.1.73482 WP_003412627.1.73507 WP_003412627.1.73532 WP_003412627.1.73564 WP_003412627.1.73623 WP_003412627.1.73629 WP_003412627.1.7366 WP_003412627.1.73661 WP_003412627.1.7368 WP_003412627.1.73688 WP_003412627.1.73723 WP_003412627.1.73750 WP_003412627.1.73760 WP_003412627.1.73774 WP_003412627.1.7379 WP_003412627.1.73813 WP_003412627.1.73840 WP_003412627.1.7389 WP_003412627.1.73986 WP_003412627.1.74016 WP_003412627.1.74039 WP_003412627.1.74083 WP_003412627.1.74101 WP_003412627.1.74107 WP_003412627.1.74120 WP_003412627.1.74129 WP_003412627.1.7417 WP_003412627.1.74190 WP_003412627.1.74210 WP_003412627.1.7423 WP_003412627.1.74259 WP_003412627.1.74262 WP_003412627.1.74269 WP_003412627.1.74282 WP_003412627.1.74291 WP_003412627.1.74296 WP_003412627.1.74304 WP_003412627.1.7432 WP_003412627.1.74347 WP_003412627.1.7436 WP_003412627.1.74378 WP_003412627.1.74382 WP_003412627.1.74395 WP_003412627.1.74401 WP_003412627.1.74432 WP_003412627.1.74442 WP_003412627.1.74477 WP_003412627.1.74487 WP_003412627.1.74499 WP_003412627.1.74504 WP_003412627.1.74511 WP_003412627.1.74523 WP_003412627.1.74525 WP_003412627.1.74551 WP_003412627.1.74555 WP_003412627.1.74628 WP_003412627.1.74641 WP_003412627.1.74653 WP_003412627.1.74660 WP_003412627.1.74683 WP_003412627.1.7469 WP_003412627.1.74725 WP_003412627.1.74760 WP_003412627.1.74786 WP_003412627.1.74809 WP_003412627.1.74870 WP_003412627.1.74888 WP_003412627.1.74952 WP_003412627.1.7496 WP_003412627.1.74988 WP_003412627.1.75043 WP_003412627.1.75045 WP_003412627.1.75055 WP_003412627.1.75078 WP_003412627.1.75081 WP_003412627.1.75120 WP_003412627.1.75163 WP_003412627.1.75200 WP_003412627.1.75202 WP_003412627.1.75234 WP_003412627.1.75239 WP_003412627.1.75250 WP_003412627.1.75281 WP_003412627.1.75342 WP_003412627.1.7535 WP_003412627.1.75376 WP_003412627.1.75391 WP_003412627.1.75395 WP_003412627.1.75441 WP_003412627.1.75510 WP_003412627.1.75581 WP_003412627.1.75598 WP_003412627.1.75635 WP_003412627.1.75645 WP_003412627.1.75665 WP_003412627.1.75671 WP_003412627.1.75741 WP_003412627.1.75749 WP_003412627.1.75772 WP_003412627.1.75774 WP_003412627.1.75833 WP_003412627.1.7585 WP_003412627.1.75868 WP_003412627.1.75878 WP_003412627.1.75927 WP_003412627.1.75946 WP_003412627.1.75968 WP_003412627.1.75974 WP_003412627.1.76007 WP_003412627.1.76016 WP_003412627.1.76032 WP_003412627.1.76037 WP_003412627.1.7604 WP_003412627.1.76045 WP_003412627.1.76052 WP_003412627.1.76058 WP_003412627.1.76064 WP_003412627.1.76110 WP_003412627.1.76126 WP_003412627.1.76133 WP_003412627.1.76138 WP_003412627.1.76157 WP_003412627.1.76172 WP_003412627.1.76177 WP_003412627.1.76183 WP_003412627.1.76209 WP_003412627.1.76239 WP_003412627.1.76272 WP_003412627.1.76277 WP_003412627.1.76280 WP_003412627.1.76291 WP_003412627.1.76360 WP_003412627.1.76379 WP_003412627.1.76403 WP_003412627.1.76413 WP_003412627.1.76414 WP_003412627.1.76427 WP_003412627.1.76436 WP_003412627.1.76442 WP_003412627.1.76443 WP_003412627.1.76456 WP_003412627.1.76521 WP_003412627.1.76616 WP_003412627.1.76625 WP_003412627.1.76629 WP_003412627.1.76635 WP_003412627.1.76638 WP_003412627.1.76639 WP_003412627.1.76640 WP_003412627.1.76644 WP_003412627.1.76677 WP_003412627.1.76678 WP_003412627.1.76679 WP_003412627.1.76734 WP_003412627.1.76744 WP_003412627.1.76750 WP_003412627.1.76754 WP_003412627.1.76757 WP_003412627.1.76781 WP_003412627.1.76818 WP_003412627.1.76824 WP_003412627.1.76835 WP_003412627.1.76873 WP_003412627.1.76881 WP_003412627.1.76888 WP_003412627.1.76900 WP_003412627.1.7691 WP_003412627.1.76947 WP_003412627.1.76954 WP_003412627.1.76955 WP_003412627.1.76963 WP_003412627.1.76976 WP_003412627.1.770 WP_003412627.1.77000 WP_003412627.1.77008 WP_003412627.1.77021 WP_003412627.1.77065 WP_003412627.1.77075 WP_003412627.1.77093 WP_003412627.1.77115 WP_003412627.1.77125 WP_003412627.1.77141 WP_003412627.1.77166 WP_003412627.1.77250 WP_003412627.1.77252 WP_003412627.1.77260 WP_003412627.1.77266 WP_003412627.1.77280 WP_003412627.1.77285 WP_003412627.1.77312 WP_003412627.1.77348 WP_003412627.1.77351 WP_003412627.1.77352 WP_003412627.1.77361 WP_003412627.1.774 WP_003412627.1.7740 WP_003412627.1.77404 WP_003412627.1.77425 WP_003412627.1.77474 WP_003412627.1.7748 WP_003412627.1.77484 WP_003412627.1.77491 WP_003412627.1.77499 WP_003412627.1.77510 WP_003412627.1.77554 WP_003412627.1.77559 WP_003412627.1.77599 WP_003412627.1.77605 WP_003412627.1.7762 WP_003412627.1.77627 WP_003412627.1.77654 WP_003412627.1.7766 WP_003412627.1.77667 WP_003412627.1.77704 WP_003412627.1.77706 WP_003412627.1.77726 WP_003412627.1.77774 WP_003412627.1.77790 WP_003412627.1.77809 WP_003412627.1.77820 WP_003412627.1.77855 WP_003412627.1.77865 WP_003412627.1.77868 WP_003412627.1.77879 WP_003412627.1.77890 WP_003412627.1.77909 WP_003412627.1.77911 WP_003412627.1.77931 WP_003412627.1.77984 WP_003412627.1.78020 WP_003412627.1.78024 WP_003412627.1.78075 WP_003412627.1.78084 WP_003412627.1.78086 WP_003412627.1.7809 WP_003412627.1.78098 WP_003412627.1.78105 WP_003412627.1.78113 WP_003412627.1.78136 WP_003412627.1.78162 WP_003412627.1.78200 WP_003412627.1.78216 WP_003412627.1.78236 WP_003412627.1.78238 WP_003412627.1.78322 WP_003412627.1.78338 WP_003412627.1.7836 WP_003412627.1.78386 WP_003412627.1.78429 WP_003412627.1.78435 WP_003412627.1.7844 WP_003412627.1.78459 WP_003412627.1.78499 WP_003412627.1.785 WP_003412627.1.78516 WP_003412627.1.78524 WP_003412627.1.78526 WP_003412627.1.78538 WP_003412627.1.78545 WP_003412627.1.78547 WP_003412627.1.78574 WP_003412627.1.78580 WP_003412627.1.7860 WP_003412627.1.78646 WP_003412627.1.78649 WP_003412627.1.78655 WP_003412627.1.78657 WP_003412627.1.78659 WP_003412627.1.78692 WP_003412627.1.78760 WP_003412627.1.78766 WP_003412627.1.78778 WP_003412627.1.78784 WP_003412627.1.78788 WP_003412627.1.78793 WP_003412627.1.78848 WP_003412627.1.78860 WP_003412627.1.7887 WP_003412627.1.78884 WP_003412627.1.78932 WP_003412627.1.78969 WP_003412627.1.78980 WP_003412627.1.79005 WP_003412627.1.79016 WP_003412627.1.79064 WP_003412627.1.79066 WP_003412627.1.79068 WP_003412627.1.79077 WP_003412627.1.79095 WP_003412627.1.79112 WP_003412627.1.79122 WP_003412627.1.79145 WP_003412627.1.79152 WP_003412627.1.79163 WP_003412627.1.79182 WP_003412627.1.79213 WP_003412627.1.79268 WP_003412627.1.79273 WP_003412627.1.79278 WP_003412627.1.79290 WP_003412627.1.79325 WP_003412627.1.79326 WP_003412627.1.7933 WP_003412627.1.79330 WP_003412627.1.79339 WP_003412627.1.79399 WP_003412627.1.79413 WP_003412627.1.79422 WP_003412627.1.79445 WP_003412627.1.79447 WP_003412627.1.79455 WP_003412627.1.79471 WP_003412627.1.79480 WP_003412627.1.79482 WP_003412627.1.79488 WP_003412627.1.79500 WP_003412627.1.79502 WP_003412627.1.79508 WP_003412627.1.79514 WP_003412627.1.79561 WP_003412627.1.79578 WP_003412627.1.79588 WP_003412627.1.79598 WP_003412627.1.79615 WP_003412627.1.79684 WP_003412627.1.79698 WP_003412627.1.797 WP_003412627.1.79744 WP_003412627.1.79784 WP_003412627.1.79802 WP_003412627.1.79806 WP_003412627.1.79819 WP_003412627.1.79826 WP_003412627.1.79851 WP_003412627.1.79853 WP_003412627.1.79863 WP_003412627.1.79881 WP_003412627.1.79885 WP_003412627.1.79898 WP_003412627.1.7990 WP_003412627.1.79900 WP_003412627.1.79913 WP_003412627.1.79918 WP_003412627.1.79947 WP_003412627.1.7995 WP_003412627.1.7997 WP_003412627.1.80015 WP_003412627.1.80022 WP_003412627.1.80030 WP_003412627.1.80084 WP_003412627.1.80099 WP_003412627.1.80129 WP_003412627.1.80177 WP_003412627.1.80234 WP_003412627.1.8026 WP_003412627.1.80275 WP_003412627.1.8029 WP_003412627.1.80299 WP_003412627.1.80300 WP_003412627.1.80304 WP_003412627.1.80326 WP_003412627.1.80351 WP_003412627.1.8037 WP_003412627.1.80370 WP_003412627.1.80399 WP_003412627.1.8044 WP_003412627.1.80451 WP_003412627.1.80458 WP_003412627.1.80461 WP_003412627.1.80490 WP_003412627.1.80503 WP_003412627.1.80507 WP_003412627.1.80552 WP_003412627.1.80576 WP_003412627.1.80588 WP_003412627.1.80599 WP_003412627.1.80624 WP_003412627.1.80636 WP_003412627.1.80673 WP_003412627.1.80711 WP_003412627.1.80714 WP_003412627.1.80743 WP_003412627.1.80784 WP_003412627.1.80815 WP_003412627.1.80918 WP_003412627.1.8093 WP_003412627.1.80967 WP_003412627.1.80988 WP_003412627.1.81007 WP_003412627.1.81013 WP_003412627.1.8105 WP_003412627.1.81059 WP_003412627.1.81063 WP_003412627.1.81066 WP_003412627.1.81075 WP_003412627.1.81091 WP_003412627.1.81119 WP_003412627.1.81125 WP_003412627.1.81136 WP_003412627.1.8114 WP_003412627.1.81189 WP_003412627.1.81192 WP_003412627.1.812 WP_003412627.1.81230 WP_003412627.1.81249 WP_003412627.1.81250 WP_003412627.1.81264 WP_003412627.1.8128 WP_003412627.1.81287 WP_003412627.1.81297 WP_003412627.1.8138 WP_003412627.1.8143 WP_003412627.1.81439 WP_003412627.1.81465 WP_003412627.1.81505 WP_003412627.1.81529 WP_003412627.1.81538 WP_003412627.1.81541 WP_003412627.1.81560 WP_003412627.1.81561 WP_003412627.1.81567 WP_003412627.1.81583 WP_003412627.1.81712 WP_003412627.1.81720 WP_003412627.1.81731 WP_003412627.1.81774 WP_003412627.1.81788 WP_003412627.1.81809 WP_003412627.1.81820 WP_003412627.1.81850 WP_003412627.1.81883 WP_003412627.1.81891 WP_003412627.1.81911 WP_003412627.1.81918 WP_003412627.1.82011 WP_003412627.1.82048 WP_003412627.1.82069 WP_003412627.1.82071 WP_003412627.1.82108 WP_003412627.1.82136 WP_003412627.1.82142 WP_003412627.1.82158 WP_003412627.1.8217 WP_003412627.1.82209 WP_003412627.1.82210 WP_003412627.1.82228 WP_003412627.1.82236 WP_003412627.1.82251 WP_003412627.1.82271 WP_003412627.1.82305 WP_003412627.1.82307 WP_003412627.1.82309 WP_003412627.1.82317 WP_003412627.1.8232 WP_003412627.1.82346 WP_003412627.1.82374 WP_003412627.1.82385 WP_003412627.1.82429 WP_003412627.1.82460 WP_003412627.1.82462 WP_003412627.1.82483 WP_003412627.1.82494 WP_003412627.1.82531 WP_003412627.1.82547 WP_003412627.1.82549 WP_003412627.1.82577 WP_003412627.1.82592 WP_003412627.1.82597 WP_003412627.1.82598 WP_003412627.1.82625 WP_003412627.1.82642 WP_003412627.1.82651 WP_003412627.1.82653 WP_003412627.1.82681 WP_003412627.1.8271 WP_003412627.1.82712 WP_003412627.1.82743 WP_003412627.1.82757 WP_003412627.1.82774 WP_003412627.1.82803 WP_003412627.1.82836 WP_003412627.1.82860 WP_003412627.1.82871 WP_003412627.1.82892 WP_003412627.1.82935 WP_003412627.1.82957 WP_003412627.1.82973 WP_003412627.1.82983 WP_003412627.1.83004 WP_003412627.1.83009 WP_003412627.1.83044 WP_003412627.1.83065 WP_003412627.1.83074 WP_003412627.1.83110 WP_003412627.1.83146 WP_003412627.1.83149 WP_003412627.1.83159 WP_003412627.1.8317 WP_003412627.1.83173 WP_003412627.1.83181 WP_003412627.1.83182 WP_003412627.1.83191 WP_003412627.1.83212 WP_003412627.1.8326 WP_003412627.1.83262 WP_003412627.1.83268 WP_003412627.1.83273 WP_003412627.1.83309 WP_003412627.1.83332 WP_003412627.1.83334 WP_003412627.1.83349 WP_003412627.1.8335 WP_003412627.1.83353 WP_003412627.1.83367 WP_003412627.1.83380 WP_003412627.1.83381 WP_003412627.1.83389 WP_003412627.1.83408 WP_003412627.1.83409 WP_003412627.1.83435 WP_003412627.1.83470 WP_003412627.1.83526 WP_003412627.1.8358 WP_003412627.1.83589 WP_003412627.1.83601 WP_003412627.1.83611 WP_003412627.1.83638 WP_003412627.1.83648 WP_003412627.1.83656 WP_003412627.1.83667 WP_003412627.1.83689 WP_003412627.1.83692 WP_003412627.1.83704 WP_003412627.1.83766 WP_003412627.1.83793 WP_003412627.1.83794 WP_003412627.1.83805 WP_003412627.1.83839 WP_003412627.1.83842 WP_003412627.1.83850 WP_003412627.1.83861 WP_003412627.1.83920 WP_003412627.1.83929 WP_003412627.1.83930 WP_003412627.1.83991 WP_003412627.1.8400 WP_003412627.1.84027 WP_003412627.1.8404 WP_003412627.1.84057 WP_003412627.1.84070 WP_003412627.1.8409 WP_003412627.1.84112 WP_003412627.1.84146 WP_003412627.1.8415 WP_003412627.1.84186 WP_003412627.1.84192 WP_003412627.1.84228 WP_003412627.1.8424 WP_003412627.1.84244 WP_003412627.1.8426 WP_003412627.1.84277 WP_003412627.1.84287 WP_003412627.1.8434 WP_003412627.1.84388 WP_003412627.1.84408 WP_003412627.1.84409 WP_003412627.1.84438 WP_003412627.1.84460 WP_003412627.1.84488 WP_003412627.1.84504 WP_003412627.1.84620 WP_003412627.1.84623 WP_003412627.1.84655 WP_003412627.1.84670 WP_003412627.1.84739 WP_003412627.1.84748 WP_003412627.1.84772 WP_003412627.1.848 WP_003412627.1.84812 WP_003412627.1.84836 WP_003412627.1.84839 WP_003412627.1.84873 WP_003412627.1.84911 WP_003412627.1.84938 WP_003412627.1.84968 WP_003412627.1.84973 WP_003412627.1.84981 WP_003412627.1.84985 WP_003412627.1.8503 WP_003412627.1.85041 WP_003412627.1.85043 WP_003412627.1.8505 WP_003412627.1.85074 WP_003412627.1.8509 WP_003412627.1.8512 WP_003412627.1.85148 WP_003412627.1.8518 WP_003412627.1.8522 WP_003412627.1.85276 WP_003412627.1.85281 WP_003412627.1.85284 WP_003412627.1.85319 WP_003412627.1.85330 WP_003412627.1.85341 WP_003412627.1.85346 WP_003412627.1.85363 WP_003412627.1.85371 WP_003412627.1.85387 WP_003412627.1.85399 WP_003412627.1.85458 WP_003412627.1.8546 WP_003412627.1.85464 WP_003412627.1.85478 WP_003412627.1.85480 WP_003412627.1.85488 WP_003412627.1.85495 WP_003412627.1.85551 WP_003412627.1.85557 WP_003412627.1.85577 WP_003412627.1.85597 WP_003412627.1.8563 WP_003412627.1.85648 WP_003412627.1.85679 WP_003412627.1.85704 WP_003412627.1.85727 WP_003412627.1.85737 WP_003412627.1.85763 WP_003412627.1.85808 WP_003412627.1.85819 WP_003412627.1.85823 WP_003412627.1.85832 WP_003412627.1.8586 WP_003412627.1.85872 WP_003412627.1.85894 WP_003412627.1.85909 WP_003412627.1.85913 WP_003412627.1.85953 WP_003412627.1.85986 WP_003412627.1.86000 WP_003412627.1.86024 WP_003412627.1.86025 WP_003412627.1.86032 WP_003412627.1.86048 WP_003412627.1.86052 WP_003412627.1.86067 WP_003412627.1.86103 WP_003412627.1.86122 WP_003412627.1.86124 WP_003412627.1.86160 WP_003412627.1.86168 WP_003412627.1.86190 WP_003412627.1.86204 WP_003412627.1.86208 WP_003412627.1.86235 WP_003412627.1.86249 WP_003412627.1.863 WP_003412627.1.86327 WP_003412627.1.86334 WP_003412627.1.86337 WP_003412627.1.86368 WP_003412627.1.86377 WP_003412627.1.86425 WP_003412627.1.86459 WP_003412627.1.8649 WP_003412627.1.86499 WP_003412627.1.86520 WP_003412627.1.86561 WP_003412627.1.86568 WP_003412627.1.86575 WP_003412627.1.86584 WP_003412627.1.86605 WP_003412627.1.86626 WP_003412627.1.86648 WP_003412627.1.8666 WP_003412627.1.86684 WP_003412627.1.86696 WP_003412627.1.86705 WP_003412627.1.86718 WP_003412627.1.86725 WP_003412627.1.86757 WP_003412627.1.86801 WP_003412627.1.86814 WP_003412627.1.86820 WP_003412627.1.86825 WP_003412627.1.86834 WP_003412627.1.8685 WP_003412627.1.86851 WP_003412627.1.86855 WP_003412627.1.86867 WP_003412627.1.86877 WP_003412627.1.86883 WP_003412627.1.8689 WP_003412627.1.86892 WP_003412627.1.86933 WP_003412627.1.86941 WP_003412627.1.86962 WP_003412627.1.86963 WP_003412627.1.86979 WP_003412627.1.8700 WP_003412627.1.87001 WP_003412627.1.87002 WP_003412627.1.87031 WP_003412627.1.87116 WP_003412627.1.87117 WP_003412627.1.8714 WP_003412627.1.87162 WP_003412627.1.87178 WP_003412627.1.87191 WP_003412627.1.87201 WP_003412627.1.87209 WP_003412627.1.87240 WP_003412627.1.87273 WP_003412627.1.87275 WP_003412627.1.8733 WP_003412627.1.87345 WP_003412627.1.87369 WP_003412627.1.8737 WP_003412627.1.87401 WP_003412627.1.87404 WP_003412627.1.87406 WP_003412627.1.87409 WP_003412627.1.87444 WP_003412627.1.87446 WP_003412627.1.87459 WP_003412627.1.87472 WP_003412627.1.87489 WP_003412627.1.87494 WP_003412627.1.87496 WP_003412627.1.87582 WP_003412627.1.87588 WP_003412627.1.87617 WP_003412627.1.87619 WP_003412627.1.87620 WP_003412627.1.87634 WP_003412627.1.87643 WP_003412627.1.8765 WP_003412627.1.87650 WP_003412627.1.87654 WP_003412627.1.87658 WP_003412627.1.87676 WP_003412627.1.87677 WP_003412627.1.87684 WP_003412627.1.87692 WP_003412627.1.87707 WP_003412627.1.87732 WP_003412627.1.87784 WP_003412627.1.87809 WP_003412627.1.87817 WP_003412627.1.87827 WP_003412627.1.87831 WP_003412627.1.87835 WP_003412627.1.87837 WP_003412627.1.87866 WP_003412627.1.8789 WP_003412627.1.87924 WP_003412627.1.87951 WP_003412627.1.87955 WP_003412627.1.87956 WP_003412627.1.87991 WP_003412627.1.88 WP_003412627.1.88002 WP_003412627.1.88037 WP_003412627.1.88039 WP_003412627.1.88072 WP_003412627.1.88077 WP_003412627.1.88121 WP_003412627.1.88180 WP_003412627.1.88191 WP_003412627.1.88205 WP_003412627.1.88217 WP_003412627.1.88219 WP_003412627.1.88245 WP_003412627.1.88253 WP_003412627.1.88294 WP_003412627.1.88315 WP_003412627.1.88316 WP_003412627.1.88320 WP_003412627.1.88338 WP_003412627.1.8840 WP_003412627.1.88437 WP_003412627.1.88453 WP_003412627.1.88469 WP_003412627.1.88489 WP_003412627.1.88507 WP_003412627.1.88521 WP_003412627.1.88530 WP_003412627.1.88537 WP_003412627.1.88541 WP_003412627.1.88592 WP_003412627.1.88616 WP_003412627.1.88618 WP_003412627.1.8862 WP_003412627.1.88632 WP_003412627.1.88634 WP_003412627.1.88649 WP_003412627.1.8870 WP_003412627.1.88737 WP_003412627.1.888 WP_003412627.1.88824 WP_003412627.1.88886 WP_003412627.1.88965 WP_003412627.1.8902 WP_003412627.1.89025 WP_003412627.1.89041 WP_003412627.1.89046 WP_003412627.1.89082 WP_003412627.1.89162 WP_003412627.1.89168 WP_003412627.1.8917 WP_003412627.1.89193 WP_003412627.1.89205 WP_003412627.1.89207 WP_003412627.1.89225 WP_003412627.1.89277 WP_003412627.1.89286 WP_003412627.1.89293 WP_003412627.1.89320 WP_003412627.1.8935 WP_003412627.1.89371 WP_003412627.1.89392 WP_003412627.1.89406 WP_003412627.1.89451 WP_003412627.1.89453 WP_003412627.1.89473 WP_003412627.1.89475 WP_003412627.1.89483 WP_003412627.1.895 WP_003412627.1.89513 WP_003412627.1.89522 WP_003412627.1.8954 WP_003412627.1.89543 WP_003412627.1.89567 WP_003412627.1.8957 WP_003412627.1.89572 WP_003412627.1.89589 WP_003412627.1.89607 WP_003412627.1.89613 WP_003412627.1.89648 WP_003412627.1.8967 WP_003412627.1.89670 WP_003412627.1.89676 WP_003412627.1.89729 WP_003412627.1.89739 WP_003412627.1.89762 WP_003412627.1.8977 WP_003412627.1.89802 WP_003412627.1.89808 WP_003412627.1.89829 WP_003412627.1.89831 WP_003412627.1.89844 WP_003412627.1.89849 WP_003412627.1.8989 WP_003412627.1.89909 WP_003412627.1.89922 WP_003412627.1.89926 WP_003412627.1.89963 WP_003412627.1.89971 WP_003412627.1.8998 WP_003412627.1.89987 WP_003412627.1.90048 WP_003412627.1.9007 WP_003412627.1.90130 WP_003412627.1.90134 WP_003412627.1.90137 WP_003412627.1.90157 WP_003412627.1.90184 WP_003412627.1.90199 WP_003412627.1.90231 WP_003412627.1.90245 WP_003412627.1.90308 WP_003412627.1.90322 WP_003412627.1.90328 WP_003412627.1.90372 WP_003412627.1.90439 WP_003412627.1.90499 WP_003412627.1.9050 WP_003412627.1.90527 WP_003412627.1.90550 WP_003412627.1.90560 WP_003412627.1.90612 WP_003412627.1.90640 WP_003412627.1.90672 WP_003412627.1.90687 WP_003412627.1.90691 WP_003412627.1.90722 WP_003412627.1.90744 WP_003412627.1.9075 WP_003412627.1.90756 WP_003412627.1.90767 WP_003412627.1.90771 WP_003412627.1.90785 WP_003412627.1.90788 WP_003412627.1.90800 WP_003412627.1.90810 WP_003412627.1.90816 WP_003412627.1.90819 WP_003412627.1.9082 WP_003412627.1.90831 WP_003412627.1.90884 WP_003412627.1.90899 WP_003412627.1.90906 WP_003412627.1.90958 WP_003412627.1.90976 WP_003412627.1.90977 WP_003412627.1.90987 WP_003412627.1.9102 WP_003412627.1.91026 WP_003412627.1.91032 WP_003412627.1.91043 WP_003412627.1.91053 WP_003412627.1.91106 WP_003412627.1.91112 WP_003412627.1.91144 WP_003412627.1.91151 WP_003412627.1.91157 WP_003412627.1.91169 WP_003412627.1.91192 WP_003412627.1.91201 WP_003412627.1.91207 WP_003412627.1.91208 WP_003412627.1.91211 WP_003412627.1.91214 WP_003412627.1.91230 WP_003412627.1.91244 WP_003412627.1.91251 WP_003412627.1.91260 WP_003412627.1.9128 WP_003412627.1.91284 WP_003412627.1.91294 WP_003412627.1.91303 WP_003412627.1.91322 WP_003412627.1.91352 WP_003412627.1.9139 WP_003412627.1.91411 WP_003412627.1.91436 WP_003412627.1.91483 WP_003412627.1.91496 WP_003412627.1.91507 WP_003412627.1.91508 WP_003412627.1.91589 WP_003412627.1.91694 WP_003412627.1.91713 WP_003412627.1.91716 WP_003412627.1.91717 WP_003412627.1.91728 WP_003412627.1.91743 WP_003412627.1.91759 WP_003412627.1.91784 WP_003412627.1.91785 WP_003412627.1.91786 WP_003412627.1.91802 WP_003412627.1.91822 WP_003412627.1.91828 WP_003412627.1.9189 WP_003412627.1.91896 WP_003412627.1.9190 WP_003412627.1.91915 WP_003412627.1.91931 WP_003412627.1.91937 WP_003412627.1.91944 WP_003412627.1.91953 WP_003412627.1.91957 WP_003412627.1.91976 WP_003412627.1.91978 WP_003412627.1.92021 WP_003412627.1.92083 WP_003412627.1.92127 WP_003412627.1.92144 WP_003412627.1.92150 WP_003412627.1.92153 WP_003412627.1.92190 WP_003412627.1.92192 WP_003412627.1.92200 WP_003412627.1.92220 WP_003412627.1.92221 WP_003412627.1.92222 WP_003412627.1.92273 WP_003412627.1.92289 WP_003412627.1.9229 WP_003412627.1.92294 WP_003412627.1.92300 WP_003412627.1.92334 WP_003412627.1.92338 WP_003412627.1.92345 WP_003412627.1.92356 WP_003412627.1.92364 WP_003412627.1.92416 WP_003412627.1.92428 WP_003412627.1.92447 WP_003412627.1.92456 WP_003412627.1.92467 WP_003412627.1.92471 WP_003412627.1.92490 WP_003412627.1.92508 WP_003412627.1.9251 WP_003412627.1.92511 WP_003412627.1.92523 WP_003412627.1.92527 WP_003412627.1.92536 WP_003412627.1.92592 WP_003412627.1.92597 WP_003412627.1.92603 WP_003412627.1.92606 WP_003412627.1.92610 WP_003412627.1.92613 WP_003412627.1.9265 WP_003412627.1.92660 WP_003412627.1.92677 WP_003412627.1.92685 WP_003412627.1.92689 WP_003412627.1.92690 WP_003412627.1.92706 WP_003412627.1.92714 WP_003412627.1.92736 WP_003412627.1.9274 WP_003412627.1.92752 WP_003412627.1.92760 WP_003412627.1.92803 WP_003412627.1.92833 WP_003412627.1.92856 WP_003412627.1.92907 WP_003412627.1.9291 WP_003412627.1.92917 WP_003412627.1.92996 WP_003412627.1.93006 WP_003412627.1.93008 WP_003412627.1.93009 WP_003412627.1.93015 WP_003412627.1.93043 WP_003412627.1.9307 WP_003412627.1.93083 WP_003412627.1.93097 WP_003412627.1.93137 WP_003412627.1.93192 WP_003412627.1.93199 WP_003412627.1.93203 WP_003412627.1.93212 WP_003412627.1.93245 WP_003412627.1.93257 WP_003412627.1.93265 WP_003412627.1.93297 WP_003412627.1.93320 WP_003412627.1.93328 WP_003412627.1.93337 WP_003412627.1.93343 WP_003412627.1.93349 WP_003412627.1.93363 WP_003412627.1.93377 WP_003412627.1.9338 WP_003412627.1.93407 WP_003412627.1.93417 WP_003412627.1.93419 WP_003412627.1.93426 WP_003412627.1.9344 WP_003412627.1.93443 WP_003412627.1.93447 WP_003412627.1.93470 WP_003412627.1.93483 WP_003412627.1.93487 WP_003412627.1.93495 WP_003412627.1.93499 WP_003412627.1.93516 WP_003412627.1.93536 WP_003412627.1.93544 WP_003412627.1.93555 WP_003412627.1.93564 WP_003412627.1.9357 WP_003412627.1.93573 WP_003412627.1.93576 WP_003412627.1.93588 WP_003412627.1.9363 WP_003412627.1.93645 WP_003412627.1.93649 WP_003412627.1.93659 WP_003412627.1.93677 WP_003412627.1.9368 WP_003412627.1.93689 WP_003412627.1.93693 WP_003412627.1.93698 WP_003412627.1.93706 WP_003412627.1.9371 WP_003412627.1.93792 WP_003412627.1.93823 WP_003412627.1.93871 WP_003412627.1.9388 WP_003412627.1.93894 WP_003412627.1.93903 WP_003412627.1.93907 WP_003412627.1.93913 WP_003412627.1.93946 WP_003412627.1.93950 WP_003412627.1.93953 WP_003412627.1.93954 WP_003412627.1.93988 WP_003412627.1.9407 WP_003412627.1.94143 WP_003412627.1.94154 WP_003412627.1.94184 WP_003412627.1.94204 WP_003412627.1.94205 WP_003412627.1.94226 WP_003412627.1.94231 WP_003412627.1.94256 WP_003412627.1.94261 WP_003412627.1.94281 WP_003412627.1.94292 WP_003412627.1.94297 WP_003412627.1.9431 WP_003412627.1.94326 WP_003412627.1.94339 WP_003412627.1.94416 WP_003412627.1.94421 WP_003412627.1.94456 WP_003412627.1.94470 WP_003412627.1.94480 WP_003412627.1.94511 WP_003412627.1.94512 WP_003412627.1.94525 WP_003412627.1.94528 WP_003412627.1.94564 WP_003412627.1.946 WP_003412627.1.94602 WP_003412627.1.94623 WP_003412627.1.94629 WP_003412627.1.9465 WP_003412627.1.94673 WP_003412627.1.94714 WP_003412627.1.94730 WP_003412627.1.94736 WP_003412627.1.94776 WP_003412627.1.9478 WP_003412627.1.94834 WP_003412627.1.94852 WP_003412627.1.94872 WP_003412627.1.94916 WP_003412627.1.94979 WP_003412627.1.94994 WP_003412627.1.94996 WP_003412627.1.94998 WP_003412627.1.95010 WP_003412627.1.95015 WP_003412627.1.95034 WP_003412627.1.95068 WP_003412627.1.95081 WP_003412627.1.95082 WP_003412627.1.9509 WP_003412627.1.95138 WP_003412627.1.95179 WP_003412627.1.95190 WP_003412627.1.95234 WP_003412627.1.95241 WP_003412627.1.95245 WP_003412627.1.95257 WP_003412627.1.95279 WP_003412627.1.9531 WP_003412627.1.95335 WP_003412627.1.95344 WP_003412627.1.9535 WP_003412627.1.95392 WP_003412627.1.95454 WP_003412627.1.95455 WP_003412627.1.95491 WP_003412627.1.95497 WP_003412627.1.95508 WP_003412627.1.95509 WP_003412627.1.95529 WP_003412627.1.95556 WP_003412627.1.95557 WP_003412627.1.95578 WP_003412627.1.95580 WP_003412627.1.95585 WP_003412627.1.95643 WP_003412627.1.95679 WP_003412627.1.95685 WP_003412627.1.957 WP_003412627.1.95724 WP_003412627.1.95727 WP_003412627.1.95730 WP_003412627.1.95735 WP_003412627.1.95758 WP_003412627.1.95772 WP_003412627.1.9585 WP_003412627.1.9590 WP_003412627.1.95908 WP_003412627.1.95924 WP_003412627.1.95926 WP_003412627.1.95953 WP_003412627.1.95958 WP_003412627.1.95973 WP_003412627.1.96006 WP_003412627.1.9602 WP_003412627.1.96036 WP_003412627.1.96062 WP_003412627.1.96065 WP_003412627.1.96098 WP_003412627.1.96146 WP_003412627.1.96166 WP_003412627.1.96182 WP_003412627.1.96204 WP_003412627.1.96230 WP_003412627.1.96235 WP_003412627.1.96242 WP_003412627.1.96245 WP_003412627.1.96259 WP_003412627.1.96286 WP_003412627.1.96313 WP_003412627.1.96318 WP_003412627.1.96345 WP_003412627.1.96360 WP_003412627.1.96373 WP_003412627.1.96456 WP_003412627.1.96486 WP_003412627.1.96569 WP_003412627.1.96573 WP_003412627.1.96575 WP_003412627.1.96576 WP_003412627.1.96611 WP_003412627.1.96621 WP_003412627.1.9667 WP_003412627.1.96681 WP_003412627.1.96726 WP_003412627.1.96733 WP_003412627.1.96742 WP_003412627.1.96754 WP_003412627.1.96832 WP_003412627.1.9685 WP_003412627.1.97008 WP_003412627.1.97009 WP_003412627.1.97056 WP_003412627.1.97084 WP_003412627.1.97087 WP_003412627.1.97094 WP_003412627.1.97096 WP_003412627.1.97099 WP_003412627.1.97108 WP_003412627.1.97113 WP_003412627.1.97122 WP_003412627.1.97127 WP_003412627.1.97129 WP_003412627.1.9716 WP_003412627.1.97176 WP_003412627.1.97222 WP_003412627.1.97223 WP_003412627.1.97237 WP_003412627.1.97242 WP_003412627.1.97270 WP_003412627.1.97283 WP_003412627.1.97296 WP_003412627.1.97321 WP_003412627.1.97325 WP_003412627.1.97330 WP_003412627.1.97366 WP_003412627.1.97376 WP_003412627.1.97380 WP_003412627.1.9739 WP_003412627.1.97517 WP_003412627.1.97519 WP_003412627.1.97540 WP_003412627.1.97545 WP_003412627.1.97550 WP_003412627.1.97577 WP_003412627.1.97584 WP_003412627.1.9759 WP_003412627.1.97591 WP_003412627.1.97596 WP_003412627.1.97609 WP_003412627.1.9763 WP_003412627.1.97669 WP_003412627.1.97673 WP_003412627.1.97700 WP_003412627.1.97701 WP_003412627.1.9773 WP_003412627.1.97730 WP_003412627.1.97740 WP_003412627.1.97751 WP_003412627.1.97797 WP_003412627.1.9782 WP_003412627.1.9784 WP_003412627.1.97888 WP_003412627.1.9790 WP_003412627.1.9795 WP_003412627.1.97958 WP_003412627.1.97966 WP_003412627.1.97977 WP_003412627.1.97979 WP_003412627.1.97995 WP_003412627.1.98018 WP_003412627.1.98034 WP_003412627.1.98052 WP_003412627.1.98071 WP_003412627.1.98072 WP_003412627.1.98113 WP_003412627.1.98114 WP_003412627.1.98128 WP_003412627.1.98181 WP_003412627.1.98189 WP_003412627.1.98213 WP_003412627.1.98225 WP_003412627.1.98291 WP_003412627.1.98335 WP_003412627.1.98350 WP_003412627.1.98395 WP_003412627.1.98412 WP_003412627.1.98441 WP_003412627.1.98443 WP_003412627.1.98462 WP_003412627.1.9848 WP_003412627.1.98482 WP_003412627.1.98486 WP_003412627.1.98488 WP_003412627.1.98503 WP_003412627.1.98516 WP_003412627.1.98524 WP_003412627.1.98536 WP_003412627.1.98541 WP_003412627.1.98566 WP_003412627.1.98576 WP_003412627.1.98590 WP_003412627.1.98594 WP_003412627.1.98599 WP_003412627.1.98629 WP_003412627.1.98645 WP_003412627.1.98649 WP_003412627.1.98656 WP_003412627.1.9867 WP_003412627.1.98674 WP_003412627.1.98697 WP_003412627.1.98701 WP_003412627.1.98739 WP_003412627.1.98749 WP_003412627.1.98765 WP_003412627.1.98777 WP_003412627.1.98778 WP_003412627.1.98802 WP_003412627.1.98838 WP_003412627.1.98850 WP_003412627.1.98906 WP_003412627.1.98935 WP_003412627.1.98948 WP_003412627.1.98953 WP_003412627.1.98984 WP_003412627.1.99023 WP_003412627.1.99030 WP_003412627.1.99037 WP_003412627.1.99055 WP_003412627.1.99062 WP_003412627.1.99086 WP_003412627.1.99115 WP_003412627.1.99117 WP_003412627.1.99161 WP_003412627.1.99205 WP_003412627.1.99211 WP_003412627.1.99216 WP_003412627.1.99251 WP_003412627.1.99269 WP_003412627.1.99294 WP_003412627.1.99312 WP_003412627.1.99315 WP_003412627.1.99316 WP_003412627.1.99328 WP_003412627.1.99365 WP_003412627.1.99368 WP_003412627.1.99379 WP_003412627.1.99396 WP_003412627.1.99402 WP_003412627.1.99404 WP_003412627.1.99419 WP_003412627.1.99438 WP_003412627.1.99460 WP_003412627.1.99468 WP_003412627.1.99529 WP_003412627.1.99548 WP_003412627.1.99572 WP_003412627.1.99575 WP_003412627.1.99578 WP_003412627.1.99605 WP_003412627.1.99617 WP_003412627.1.99650 WP_003412627.1.99672 WP_003412627.1.99701 WP_003412627.1.99711 WP_003412627.1.99716 WP_003412627.1.99740 WP_003412627.1.99745 WP_003412627.1.99749 WP_003412627.1.9976 WP_003412627.1.99798 WP_003412627.1.99817 WP_003412627.1.99832 WP_003412627.1.99847 WP_003412627.1.99852 WP_003412627.1.99886 WP_003412627.1.99899 WP_003412627.1.99915 WP_003412627.1.9993 WP_003412627.1.99982 WP_003412627.1.99991 gi|339632483|ref|YP_004724125.1| gi|148662290|ref|YP_001283813.1| gi|15609592|ref|NP_216971.1| gi|479315402|ref|YP_007855454.1| gi|479056419|ref|YP_007352225.1| gi|506926987|ref|YP_008007437.1| gi|383308233|ref|YP_005361044.1| gi|449064525|ref|YP_007431608.1| 233413.Mb2482c 336982.TBFG_12480 410289.BCG_2475c 419947.MRA_2481 561275.JTY_2469 83332.Rv2455c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]