SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 410358.Mlab_0048 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410358.Mlab_0048
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-40
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 410358.Mlab_0048
Sequence length 176
Comment (Methanocorpusculum labreanum Z)
Sequence
MYEIRIHSRGGQGGVTAARMMATAAVKDGKFATACPFYGAERRGAPIVSFVRIDDAPVRI
YSQINKPDMIVILDPTVMDTVNVLDGLKEGGSIFINTHDDVDFPAGFKVYKADLTGIALR
ENLVVAGSPIVNTPVIGALAKLGLFSRESGVKAITETFADPRNTAAAKAAYEEVIV
Download sequence
Identical sequences A2SPH0
410358.Mlab_0048 WP_011832427.1.86236 gi|124484877|ref|YP_001029493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]