SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 410358.Mlab_1238 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410358.Mlab_1238
Domain Number 1 Region: 131-398
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.47e-90
Family Enolase 0.00000274
Further Details:      
 
Domain Number 2 Region: 4-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.76e-35
Family Enolase N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 410358.Mlab_1238
Sequence length 399
Comment (Methanocorpusculum labreanum Z)
Sequence
MTEISDILLRTILDSRGNPTVEAEISTISGGFGRACAPSGASTGIYEAKVRPCDEAVADA
YINLIPKLIELDSADQRGFDDTLHEVDGTSDLSGIGANIAVALSLANAKAAASTLNMELY
QYLGGAFISQTPLPLGNVIGGGAHAVDATDIQEFLIVPTGASTAAEAVFTNALVHKRIKE
ILIARGKGCGKGDEGGWAPHIADLEAFEIVNEATTKVFDETGIEVRMGLDVAASEMWDAA
SGRYVYKNAKRTTEEQIAYIADLTEKYNLIYVEDPIQEEDFEGFARITEEVSGRDTLICG
DDLFVTNASRLEEGIRNDACNCVLIKPNQIGTLTDTFETISLAHDYGYETVMSHRSGETT
DNTIAHLATAFGCCFMKSGVVGGERIAKLNELIRIEEHF
Download sequence
Identical sequences A2SSV1
gi|124486058|ref|YP_001030674.1| WP_011833610.1.86236 410358.Mlab_1238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]