SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 410358.Mlab_1651 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410358.Mlab_1651
Domain Number 1 Region: 26-172
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.13e-19
Family GHMP Kinase, N-terminal domain 0.0059
Further Details:      
 
Weak hits

Sequence:  410358.Mlab_1651
Domain Number - Region: 228-265
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00412
Family Mevalonate kinase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 410358.Mlab_1651
Sequence length 280
Comment (Methanocorpusculum labreanum Z)
Sequence
MIGKGMSYGALSVINAVSTGKGAAFGIDLKTEATVQLISEPEFTVEIDGHPTESVSLARF
SVEEVLQRYPNAGMNGAVIRTTSNIPISQGLKSSSSAANAIISATAAALGVTIDPLEIGR
IGATAAIRAGVSITGAFDDACACQLGGLVFTDNSNRELLLRRPMPEGYTAVIHIPPFQIR
KTTFPSEKMREMREMVAAAYDLAVEGDVFSAMYVNGRCTCEAIGITPETADRALSCGAAA
AGLSGTGPATGILVPDEGLDEFLDRFGRENVLLANIRNGV
Download sequence
Identical sequences A2SU06
410358.Mlab_1651 gi|124486463|ref|YP_001031079.1| WP_011834015.1.86236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]