SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 410359.Pcal_0046 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410359.Pcal_0046
Domain Number 1 Region: 56-116
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000131
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 410359.Pcal_0046
Sequence length 120
Comment (Pyrobaculum calidifontis JCM 11548)
Sequence
MRLLLLLALLDDLLLLAAPAVVALALYALGVIPLWAAAAVAAPFAALAAYVGAKVVKERP
RGFAYVGGRGVAVEDLGPRGVVKIGGEYWRAVCVGGCTVSAGSCVELVEVRDGVAYVTPC
Download sequence
Identical sequences A3MS69
410359.Pcal_0046 gi|126458674|ref|YP_001054952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]