SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 410359.Pcal_0561 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410359.Pcal_0561
Domain Number 1 Region: 176-431
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.76e-64
Family PFOR Pyr module 0.079
Further Details:      
 
Domain Number 2 Region: 3-200
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.11e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 
Domain Number 3 Region: 445-538
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000785
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 410359.Pcal_0561
Sequence length 541
Comment (Pyrobaculum calidifontis JCM 11548)
Sequence
MDLTIRISGAQGEGVETVGRLLAKSFAQLGYHVFAYRQYGSIIKGNPTMFYQVRVSDEKI
YSHGTWRSYDVLVALNDKALQAHRGGARHVISESEIPFTEIAVKHGDRIMRNTAALGALA
ALIGMELTPIEGVIRREFGERGEKIAEANIAVLRAAYDAALKRLGSVYEVKRVGEPRVLM
SGAEALAVGAVMSGMKFYAAYPMTPASPILHWLAEWGPKFGVAVVQPEDEIAAINMAIGA
AYAGVRAAVGTSGGGFDLMHEAFGLAAMIETPLVVFLAQRGGPSTGVPTETEQSDLLMAL
SPSHGEYPHVVIAPRWIEEGLYATAKAFNIAEKYQVPVIVLVDLYFTESLATVEFDPHRF
KIERGELLQGPLVWEEYKRYKIAESGVSPRALPGTPGGMHIATSDEHDERGDVITDTHQP
AIRKAMHQKRMVKLTKIVEEMEPPMIQEGDVVALAWGSTAMPLLDYAKGRKVGLALFRDL
YPLSVDGWAQRLNEAKEVVAVELNYRGQFAEYLASKGVKVTRRVLKWWGEPFSIDELGEW
L
Download sequence
Identical sequences A3MTM1
410359.Pcal_0561 gi|126459176|ref|YP_001055454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]