SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 410359.Pcal_1767 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410359.Pcal_1767
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.05e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 410359.Pcal_1767
Sequence length 186
Comment (Pyrobaculum calidifontis JCM 11548)
Sequence
MYEVVFLGRGGQGAVTAAQLLAYAATLEGKKAQALPEFGAERRGAIVRAYLRFGETLLHS
SVKEADYVVVLDGRILEQIDVRRYGKPGAVYIVNTKSKAEWYIGIDATAIALKYGLVVAG
WPVVNLIMASAFAAVSRLVSLKSIIDAVPVFVPKKYIEPNVKAVEEAYRTVEELLKSQGQ
RPASIA
Download sequence
Identical sequences A3MX17
gi|126460372|ref|YP_001056650.1| 410359.Pcal_1767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]