SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 411154.GFO_0259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  411154.GFO_0259
Domain Number - Region: 76-144
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0165
Family Anti-sigma factor antagonist SpoIIaa 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 411154.GFO_0259
Sequence length 360
Comment (Gramella forsetii KT0803)
Sequence
MKNRKQIRHNRAQKRYRRGQASKRKEKIRNRENQGLSKSQRAEFHRFNRRFKGYTKIKAP
QNFSLVEKPEKTIKFIRSIKKLYKRKTKVFVNFEEVTHIGYDALVLLLSILIRFKSKGIP
FNGNFPANEEVRKILLDSGFFEYLYRNIKEEDRYSLIKGGTIATHAYKKVDSELTSKVIT
DASKTIWKKSKRCQGVQRSLIELMHNTNNHAAFDKEGEKHWFLSVQHRKSEGVVSFSFLD
FGVGIFESLNKKGKSSKWYKWESALSRLFTFSNNKELLKLILNGDLHRTVTGKIYRGKGL
PGIYEAYKRNHFNKLHIISNDVYADIDNNKFLSLKNTFSGTFVYWELSSDNFNTDGFNND
Download sequence
Identical sequences A0LY00
411154.GFO_0259 WP_011708183.1.75286 gi|120434626|ref|YP_860316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]