SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 412022.BMA10229_A2383 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412022.BMA10229_A2383
Domain Number 1 Region: 95-361
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.68e-78
Family D-glucarate dehydratase-like 0.0000608
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.05e-32
Family Enolase N-terminal domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 412022.BMA10229_A2383
Sequence length 382
Comment (Burkholderia mallei NCTC 10229)
Sequence
MKITRLETFVVPPRWLFLKIETDAGIVGWGEPIVEGRAHTVEAAVHELADYLVSQDPLRI
EDHWQVMYRAGFYRGGPITMSAIAGIDQALWDIKGKHHGAPVHALLGGPVRERIKVYSWI
GGDRPSDVANNARAVVERGFQAVKMNGSEELQIVDTFDKVDKVIANVAAVRDAVGPYVGI
GVDFHGRVHKPMAKVLARELDPYKLMFIEEPVLSENAEALRDIANQTSTPIALGERLYSR
WDFKRILEGGYVDIVQPDASHAGGITECRKIATLAESYDVALALHCPLGPIALAACLQLD
AVSYNAFIQEQSLGIHYNQGSDLLDYLRNPDVFRYADGFVAIPQGPGLGIDVDEDKVREM
AKTGHRWRNPVWRHADGSVAEW
Download sequence
Identical sequences A0A0H2WIM6 A0A153KEA2 A2S8S6 C4B3J6
gi|126450784|ref|YP_001081990.1| 243160.BMA0254 320388.BMASAVP1_A2694 320389.BMA10247_2464 412022.BMA10229_A2383 gi|121598850|ref|YP_993990.1| gi|124385678|ref|YP_001028345.1| gi|53724706|ref|YP_102085.1| WP_004199088.1.100104 WP_004199088.1.100727 WP_004199088.1.13925 WP_004199088.1.20531 WP_004199088.1.21442 WP_004199088.1.22625 WP_004199088.1.26445 WP_004199088.1.28453 WP_004199088.1.29148 WP_004199088.1.31831 WP_004199088.1.3251 WP_004199088.1.33419 WP_004199088.1.33543 WP_004199088.1.34747 WP_004199088.1.35757 WP_004199088.1.35878 WP_004199088.1.38946 WP_004199088.1.39349 WP_004199088.1.40191 WP_004199088.1.41477 WP_004199088.1.43899 WP_004199088.1.44540 WP_004199088.1.4810 WP_004199088.1.48407 WP_004199088.1.53977 WP_004199088.1.57679 WP_004199088.1.61073 WP_004199088.1.61588 WP_004199088.1.66594 WP_004199088.1.67393 WP_004199088.1.69508 WP_004199088.1.72545 WP_004199088.1.72798 WP_004199088.1.74675 WP_004199088.1.75230 WP_004199088.1.75861 WP_004199088.1.78557 WP_004199088.1.79653 WP_004199088.1.82283 WP_004199088.1.84063 WP_004199088.1.84480 WP_004199088.1.9236 WP_004199088.1.9281 WP_004199088.1.95952 WP_004199088.1.96660 WP_004199088.1.98066 YP_102085.1.87047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]